Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2423090..2423694 | Replicon | chromosome |
| Accession | NZ_CP125619 | ||
| Organism | Pseudomonas sp. PMCC200367 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | QFX16_RS11105 | Protein ID | WP_283183931.1 |
| Coordinates | 2423401..2423694 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | W6VBC7 |
| Locus tag | QFX16_RS11100 | Protein ID | WP_008153842.1 |
| Coordinates | 2423090..2423398 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFX16_RS11080 | 2418802..2420295 | + | 1494 | WP_283183927.1 | ATP-binding protein | - |
| QFX16_RS11085 | 2420264..2421694 | + | 1431 | WP_283183928.1 | sigma-54 dependent transcriptional regulator | - |
| QFX16_RS11090 | 2421698..2422084 | - | 387 | WP_283183929.1 | hypothetical protein | - |
| QFX16_RS11095 | 2422264..2423076 | + | 813 | WP_283183930.1 | class I SAM-dependent methyltransferase | - |
| QFX16_RS11100 | 2423090..2423398 | - | 309 | WP_008153842.1 | putative addiction module antidote protein | Antitoxin |
| QFX16_RS11105 | 2423401..2423694 | - | 294 | WP_283183931.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFX16_RS11110 | 2423859..2424527 | + | 669 | WP_283183932.1 | ABC transporter ATP-binding protein | - |
| QFX16_RS11115 | 2424529..2427000 | + | 2472 | WP_283184550.1 | FtsX-like permease family protein | - |
| QFX16_RS11120 | 2426990..2428054 | + | 1065 | WP_283183933.1 | lipocalin-like domain-containing protein | - |
| QFX16_RS11125 | 2428117..2428359 | + | 243 | WP_283183934.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10696.48 Da Isoelectric Point: 10.6584
>T282160 WP_283183931.1 NZ_CP125619:c2423694-2423401 [Pseudomonas sp. PMCC200367]
MNYLIQQTMIFATWHASVRDLRAKLAIARRIDRASAGNLGDIKPVGDGVSEMRVDVGAGYRVYFTMRNCVVIVLLAGGDK
SSQTADIRRAKKLAKEV
MNYLIQQTMIFATWHASVRDLRAKLAIARRIDRASAGNLGDIKPVGDGVSEMRVDVGAGYRVYFTMRNCVVIVLLAGGDK
SSQTADIRRAKKLAKEV
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|