Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1886026..1886642 | Replicon | chromosome |
| Accession | NZ_CP125619 | ||
| Organism | Pseudomonas sp. PMCC200367 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QFX16_RS08630 | Protein ID | WP_283183591.1 |
| Coordinates | 1886026..1886238 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QFX16_RS08635 | Protein ID | WP_283183592.1 |
| Coordinates | 1886238..1886642 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFX16_RS08605 | 1881987..1882391 | + | 405 | WP_283183588.1 | hypothetical protein | - |
| QFX16_RS08610 | 1882612..1883079 | - | 468 | WP_283183589.1 | helix-turn-helix domain-containing protein | - |
| QFX16_RS08615 | 1883174..1883650 | - | 477 | Protein_1698 | LysR family transcriptional regulator | - |
| QFX16_RS08620 | 1883783..1884712 | - | 930 | WP_283180508.1 | transposase | - |
| QFX16_RS08625 | 1885026..1885745 | - | 720 | WP_283183590.1 | SDR family oxidoreductase | - |
| QFX16_RS08630 | 1886026..1886238 | + | 213 | WP_283183591.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QFX16_RS08635 | 1886238..1886642 | + | 405 | WP_283183592.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QFX16_RS08640 | 1886703..1887908 | - | 1206 | WP_283183593.1 | MFS transporter | - |
| QFX16_RS08645 | 1888222..1889220 | - | 999 | WP_283183594.1 | sulfate ABC transporter substrate-binding protein | - |
| QFX16_RS08650 | 1889335..1890159 | - | 825 | WP_283183595.1 | ion transporter | - |
| QFX16_RS08655 | 1890181..1891104 | - | 924 | WP_283183596.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7935.20 Da Isoelectric Point: 10.1424
>T282159 WP_283183591.1 NZ_CP125619:1886026-1886238 [Pseudomonas sp. PMCC200367]
VQSRLLIKELEEAGWILDRITGSHHLFKHRYNPYTIPVPHPKKDLPIGTVKSIRRRAGLYCPGASYAGDP
VQSRLLIKELEEAGWILDRITGSHHLFKHRYNPYTIPVPHPKKDLPIGTVKSIRRRAGLYCPGASYAGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14761.76 Da Isoelectric Point: 4.3841
>AT282159 WP_283183592.1 NZ_CP125619:1886238-1886642 [Pseudomonas sp. PMCC200367]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDTFEDAYNAAVEIAHIMLQEIAADGESIPMPTSAAVHRGNPDFADMGWGM
LELDIAPYMGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRH
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDTFEDAYNAAVEIAHIMLQEIAADGESIPMPTSAAVHRGNPDFADMGWGM
LELDIAPYMGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRH
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|