Detailed information of TA system TA282158

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RHH(antitoxin)
• Location: 1549782..1550295
• Replicon: chromosome
• Accession: NZ_CP125619
• Organism: Pseudomonas sp. PMCC200367

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: QFX16_RS06940
• Protein ID: WP_283183338.1
• Coordinates: 1549782..1550066 (-)
• Length: 95 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: QFX16_RS06945
• Protein ID: WP_283183339.1
• Coordinates: 1550056..1550295 (-)
• Length: 80 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QFX16_RS06915	1545920..1547155	-	1236	WP_283183335.1	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	-
QFX16_RS06920	1547395..1547853	+	459	Protein_1361	LysR family transcriptional regulator	-
QFX16_RS06925	1547853..1548173	+	321	Protein_1362	MFS transporter	-
QFX16_RS06930	1548279..1548767	-	489	WP_283183336.1	DMT family transporter	-
QFX16_RS06935	1548845..1549756	+	912	WP_283183337.1	LysR family transcriptional regulator	-
QFX16_RS06940	1549782..1550066	-	285	WP_283183338.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
QFX16_RS06945	1550056..1550295	-	240	WP_283183339.1	CopG family ribbon-helix-helix protein	Antitoxin
QFX16_RS06950	1550512..1551240	+	729	WP_283184528.1	hypothetical protein	-
QFX16_RS06955	1551245..1551661	+	417	WP_283183340.1	fosfomycin resistance glutathione transferase	-
QFX16_RS06960	1551723..1552361	+	639	WP_283183341.1	LysE family translocator	-
QFX16_RS06965	1552447..1553796	+	1350	WP_283183342.1	diguanylate cyclase	-
QFX16_RS06970	1553912..1554070	+	159	WP_283183343.1	KGG domain-containing protein	-
QFX16_RS06975	1554144..1554647	+	504	WP_283183344.1	DUF4142 domain-containing protein	-
QFX16_RS06980	1554693..1555103	-	411	WP_283183345.1	low affinity iron permease family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (3-89)

Antitoxin

• Ribbon-helix-helix protein, CopG (5-41)

Sequences

Toxin

Protein

• Length: 95 a.a.
• Molecular weight: 10935.63 Da
• Isoelectric Point: 10.8916

>T282158 WP_283183338.1 NZ_CP125619:c1550066-1549782 [Pseudomonas sp. PMCC200367]
MRVEWLRTALKNLDDEAAYIAMENPKAAADFVQAILANVDHLARFPATGREGRLPGTREWVLPDRPYLIPYRVRQGRLQA
LRVFHTRRLPPTNW

Nucleotide

• Length: 285 bp

Antitoxin

Protein

• Length: 80 a.a.
• Molecular weight: 8608.70 Da
• Isoelectric Point: 4.2958

>AT282158 WP_283183339.1 NZ_CP125619:c1550295-1550056 [Pseudomonas sp. PMCC200367]
MSVMSLRLPDELADTLANLAKATGRSKSFLAVDALREYLAREAWQIEEIQKALKEADAGDFATPEEVNAIADKWTANAG

Nucleotide

• Length: 240 bp