Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 247521..248164 | Replicon | chromosome |
Accession | NZ_CP125619 | ||
Organism | Pseudomonas sp. PMCC200367 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0Q6Q0X4 |
Locus tag | QFX16_RS01115 | Protein ID | WP_046045491.1 |
Coordinates | 247521..247703 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QFX16_RS01120 | Protein ID | WP_283182495.1 |
Coordinates | 247700..248164 (+) | Length | 155 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFX16_RS01095 | 243292..244218 | + | 927 | WP_283182494.1 | serine acetyltransferase | - |
QFX16_RS01100 | 244715..246670 | + | 1956 | WP_283184499.1 | choline transporter BetT | - |
QFX16_RS01105 | 246679..246939 | - | 261 | WP_095127627.1 | hypothetical protein | - |
QFX16_RS01110 | 247075..247380 | - | 306 | WP_283184500.1 | SDR family oxidoreductase | - |
QFX16_RS01115 | 247521..247703 | + | 183 | WP_046045491.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QFX16_RS01120 | 247700..248164 | + | 465 | WP_283182495.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QFX16_RS01125 | 248336..249373 | + | 1038 | WP_283182496.1 | L-glyceraldehyde 3-phosphate reductase | - |
QFX16_RS01130 | 249425..250267 | - | 843 | WP_283182497.1 | taurine dioxygenase | - |
QFX16_RS01135 | 250328..251161 | - | 834 | WP_283182498.1 | taurine ABC transporter permease TauC | - |
QFX16_RS01140 | 251158..251952 | - | 795 | WP_283182499.1 | taurine ABC transporter ATP-binding subunit | - |
QFX16_RS01145 | 251968..252945 | - | 978 | WP_008149275.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6883.05 Da Isoelectric Point: 10.3203
>T282154 WP_046045491.1 NZ_CP125619:247521-247703 [Pseudomonas sp. PMCC200367]
MRSREMIRMIEEDGWYLVAVKGSHHQYKHPCKPGRVTIKHPDSDLPKGTINSILKQAGLK
MRSREMIRMIEEDGWYLVAVKGSHHQYKHPCKPGRVTIKHPDSDLPKGTINSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 155 a.a. Molecular weight: 16816.65 Da Isoelectric Point: 4.2687
>AT282154 WP_283182495.1 NZ_CP125619:247700-248164 [Pseudomonas sp. PMCC200367]
MSPDTGYESPERATSQEGLSEMKFPVVLHKDADSEYGVIIPDVPGCFSAGGTVAQAFENVKEALSLHYEGLVADGDPLPQ
VHEIDAHLDNPDYAGGVWGVVEFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
MSPDTGYESPERATSQEGLSEMKFPVVLHKDADSEYGVIIPDVPGCFSAGGTVAQAFENVKEALSLHYEGLVADGDPLPQ
VHEIDAHLDNPDYAGGVWGVVEFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
Download Length: 465 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|