Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2462694..2463298 | Replicon | chromosome |
Accession | NZ_CP125618 | ||
Organism | Pseudomonas sp. PMCC200344 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QFW87_RS11145 | Protein ID | WP_283190506.1 |
Coordinates | 2463005..2463298 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | W6VBC7 |
Locus tag | QFW87_RS11140 | Protein ID | WP_008153842.1 |
Coordinates | 2462694..2463002 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFW87_RS11120 | 2458406..2459899 | + | 1494 | WP_283190503.1 | ATP-binding protein | - |
QFW87_RS11125 | 2459868..2461298 | + | 1431 | WP_283190504.1 | sigma-54 dependent transcriptional regulator | - |
QFW87_RS11130 | 2461302..2461688 | - | 387 | WP_283183929.1 | hypothetical protein | - |
QFW87_RS11135 | 2461868..2462680 | + | 813 | WP_283190505.1 | methyltransferase domain-containing protein | - |
QFW87_RS11140 | 2462694..2463002 | - | 309 | WP_008153842.1 | putative addiction module antidote protein | Antitoxin |
QFW87_RS11145 | 2463005..2463298 | - | 294 | WP_283190506.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QFW87_RS11150 | 2463463..2464131 | + | 669 | WP_283190507.1 | ABC transporter ATP-binding protein | - |
QFW87_RS11155 | 2464133..2466604 | + | 2472 | WP_283190903.1 | FtsX-like permease family protein | - |
QFW87_RS11160 | 2466594..2467658 | + | 1065 | WP_283190508.1 | lipocalin-like domain-containing protein | - |
QFW87_RS11165 | 2467721..2467963 | + | 243 | WP_283190509.1 | hypothetical protein | - |
QFW87_RS11170 | 2467975..2468142 | + | 168 | WP_162842855.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10680.42 Da Isoelectric Point: 10.8628
>T282152 WP_283190506.1 NZ_CP125618:c2463298-2463005 [Pseudomonas sp. PMCC200344]
MNYLIQQTMIFATWHASVRDLRAKLAIARRIDRASAGNLGDIKPVGDGVSEMRVDVGAGYRVYFTMRNSVVIVLLAGGDK
SSQTADIRRAKKLAKEV
MNYLIQQTMIFATWHASVRDLRAKLAIARRIDRASAGNLGDIKPVGDGVSEMRVDVGAGYRVYFTMRNSVVIVLLAGGDK
SSQTADIRRAKKLAKEV
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|