Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1878131..1878747 | Replicon | chromosome |
Accession | NZ_CP125618 | ||
Organism | Pseudomonas sp. PMCC200344 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QFW87_RS08425 | Protein ID | WP_283190259.1 |
Coordinates | 1878131..1878343 (+) | Length | 71 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QFW87_RS08430 | Protein ID | WP_283183592.1 |
Coordinates | 1878343..1878747 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFW87_RS08395 | 1873632..1874105 | + | 474 | WP_283190256.1 | cytochrome c-type biogenesis protein CcmH | - |
QFW87_RS08400 | 1874098..1875300 | + | 1203 | WP_283183587.1 | c-type cytochrome biogenesis protein CcmI | - |
QFW87_RS08405 | 1875315..1875719 | + | 405 | WP_283183588.1 | hypothetical protein | - |
QFW87_RS08410 | 1875940..1876407 | - | 468 | WP_283190257.1 | helix-turn-helix domain-containing protein | - |
QFW87_RS08415 | 1876527..1877000 | - | 474 | Protein_1657 | LysR family transcriptional regulator | - |
QFW87_RS08420 | 1877131..1877850 | - | 720 | WP_283190258.1 | SDR family oxidoreductase | - |
QFW87_RS08425 | 1878131..1878343 | + | 213 | WP_283190259.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QFW87_RS08430 | 1878343..1878747 | + | 405 | WP_283183592.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QFW87_RS08435 | 1878808..1880013 | - | 1206 | WP_283190260.1 | MFS transporter | - |
QFW87_RS08440 | 1880327..1881325 | - | 999 | WP_283183594.1 | sulfate ABC transporter substrate-binding protein | - |
QFW87_RS08445 | 1881440..1882264 | - | 825 | WP_283183595.1 | ion transporter | - |
QFW87_RS08450 | 1882286..1883209 | - | 924 | WP_283190261.1 | urea transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7921.23 Da Isoelectric Point: 9.8888
>T282151 WP_283190259.1 NZ_CP125618:1878131-1878343 [Pseudomonas sp. PMCC200344]
VQSRLLIKELEEAGWILDRIAGSHHLFKHRYNPYTIPVPHPKKDLPIGTVKCIRRRAGLYCPGASYAGDP
VQSRLLIKELEEAGWILDRIAGSHHLFKHRYNPYTIPVPHPKKDLPIGTVKCIRRRAGLYCPGASYAGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14761.76 Da Isoelectric Point: 4.3841
>AT282151 WP_283183592.1 NZ_CP125618:1878343-1878747 [Pseudomonas sp. PMCC200344]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDTFEDAYNAAVEIAHIMLQEIAADGESIPMPTSAAVHRGNPDFADMGWGM
LELDIAPYMGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRH
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDTFEDAYNAAVEIAHIMLQEIAADGESIPMPTSAAVHRGNPDFADMGWGM
LELDIAPYMGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRH
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|