Detailed information of TA system TA282150

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RHH(antitoxin)
• Location: 1541688..1542201
• Replicon: chromosome
• Accession: NZ_CP125618
• Organism: Pseudomonas sp. PMCC200344

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: QFW87_RS06955
• Protein ID: WP_283190884.1
• Coordinates: 1541688..1541972 (-)
• Length: 95 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: QFW87_RS06960
• Protein ID: WP_283183339.1
• Coordinates: 1541962..1542201 (-)
• Length: 80 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QFW87_RS06930	1537831..1539066	-	1236	WP_283183335.1	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	-
QFW87_RS06935	1539306..1539764	+	459	Protein_1363	LysR family transcriptional regulator	-
QFW87_RS06940	1539764..1540078	+	315	Protein_1364	MFS transporter	-
QFW87_RS06945	1540185..1540673	-	489	WP_283190126.1	DMT family transporter	-
QFW87_RS06950	1540751..1541662	+	912	WP_283190127.1	LysR family transcriptional regulator	-
QFW87_RS06955	1541688..1541972	-	285	WP_283190884.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
QFW87_RS06960	1541962..1542201	-	240	WP_283183339.1	CopG family ribbon-helix-helix protein	Antitoxin
QFW87_RS06965	1542418..1543146	+	729	WP_283190885.1	hypothetical protein	-
QFW87_RS06970	1543151..1543567	+	417	WP_283183340.1	fosfomycin resistance glutathione transferase	-
QFW87_RS06975	1543629..1544267	+	639	WP_283183341.1	LysE family translocator	-
QFW87_RS06980	1544353..1545702	+	1350	WP_283183342.1	diguanylate cyclase	-
QFW87_RS06985	1545818..1545976	+	159	WP_283183343.1	KGG domain-containing protein	-
QFW87_RS06990	1546050..1546553	+	504	WP_283190128.1	DUF4142 domain-containing protein	-
QFW87_RS06995	1546599..1547009	-	411	WP_283183345.1	low affinity iron permease family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (3-89)

Antitoxin

• Ribbon-helix-helix protein, CopG (5-41)

Sequences

Toxin

Protein

• Length: 95 a.a.
• Molecular weight: 10948.63 Da
• Isoelectric Point: 10.8916

>T282150 WP_283190884.1 NZ_CP125618:c1541972-1541688 [Pseudomonas sp. PMCC200344]
MRVEWLRNALKNLDDEAAYIAMENPKAAADFVQAILANVDHLARFPATGREGRLPGTREWVLPDRPYLIPYRVRQGRLQA
LRVFHTRRLPPTNW

Nucleotide

• Length: 285 bp

Antitoxin

Protein

• Length: 80 a.a.
• Molecular weight: 8608.70 Da
• Isoelectric Point: 4.2958

>AT282150 WP_283183339.1 NZ_CP125618:c1542201-1541962 [Pseudomonas sp. PMCC200344]
MSVMSLRLPDELADTLANLAKATGRSKSFLAVDALREYLAREAWQIEEIQKALKEADAGDFATPEEVNAIADKWTANAG

Nucleotide

• Length: 240 bp