Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 1541688..1542201 Replicon chromosome
Accession NZ_CP125618
Organism Pseudomonas sp. PMCC200344

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QFW87_RS06955 Protein ID WP_283190884.1
Coordinates 1541688..1541972 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QFW87_RS06960 Protein ID WP_283183339.1
Coordinates 1541962..1542201 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFW87_RS06930 1537831..1539066 - 1236 WP_283183335.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
QFW87_RS06935 1539306..1539764 + 459 Protein_1363 LysR family transcriptional regulator -
QFW87_RS06940 1539764..1540078 + 315 Protein_1364 MFS transporter -
QFW87_RS06945 1540185..1540673 - 489 WP_283190126.1 DMT family transporter -
QFW87_RS06950 1540751..1541662 + 912 WP_283190127.1 LysR family transcriptional regulator -
QFW87_RS06955 1541688..1541972 - 285 WP_283190884.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QFW87_RS06960 1541962..1542201 - 240 WP_283183339.1 CopG family ribbon-helix-helix protein Antitoxin
QFW87_RS06965 1542418..1543146 + 729 WP_283190885.1 hypothetical protein -
QFW87_RS06970 1543151..1543567 + 417 WP_283183340.1 fosfomycin resistance glutathione transferase -
QFW87_RS06975 1543629..1544267 + 639 WP_283183341.1 LysE family translocator -
QFW87_RS06980 1544353..1545702 + 1350 WP_283183342.1 diguanylate cyclase -
QFW87_RS06985 1545818..1545976 + 159 WP_283183343.1 KGG domain-containing protein -
QFW87_RS06990 1546050..1546553 + 504 WP_283190128.1 DUF4142 domain-containing protein -
QFW87_RS06995 1546599..1547009 - 411 WP_283183345.1 low affinity iron permease family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-41)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10948.63 Da        Isoelectric Point: 10.8916

>T282150 WP_283190884.1 NZ_CP125618:c1541972-1541688 [Pseudomonas sp. PMCC200344]
MRVEWLRNALKNLDDEAAYIAMENPKAAADFVQAILANVDHLARFPATGREGRLPGTREWVLPDRPYLIPYRVRQGRLQA
LRVFHTRRLPPTNW

Download         Length: 285 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8608.70 Da        Isoelectric Point: 4.2958

>AT282150 WP_283183339.1 NZ_CP125618:c1542201-1541962 [Pseudomonas sp. PMCC200344]
MSVMSLRLPDELADTLANLAKATGRSKSFLAVDALREYLAREAWQIEEIQKALKEADAGDFATPEEVNAIADKWTANAG

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References