Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 329450..330087 | Replicon | chromosome |
Accession | NZ_CP125618 | ||
Organism | Pseudomonas sp. PMCC200344 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QFW87_RS01525 | Protein ID | WP_283189655.1 |
Coordinates | 329450..329857 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QFW87_RS01530 | Protein ID | WP_283189656.1 |
Coordinates | 329857..330087 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFW87_RS01505 | 325112..325807 | - | 696 | WP_149416717.1 | ABC transporter permease | - |
QFW87_RS01510 | 325886..326632 | - | 747 | WP_095127574.1 | ABC transporter substrate-binding protein | - |
QFW87_RS01515 | 326646..327419 | - | 774 | WP_007897462.1 | ABC transporter ATP-binding protein | - |
QFW87_RS01520 | 327983..329374 | + | 1392 | WP_283189654.1 | GABA permease | - |
QFW87_RS01525 | 329450..329857 | - | 408 | WP_283189655.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QFW87_RS01530 | 329857..330087 | - | 231 | WP_283189656.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QFW87_RS01535 | 330276..330728 | - | 453 | WP_283189657.1 | hypothetical protein | - |
QFW87_RS01540 | 330735..331151 | - | 417 | WP_283182552.1 | hypothetical protein | - |
QFW87_RS01545 | 331189..332163 | - | 975 | WP_283189658.1 | alpha/beta fold hydrolase | - |
QFW87_RS01550 | 332212..333288 | - | 1077 | WP_283182554.1 | PDDEXK nuclease domain-containing protein | - |
QFW87_RS01555 | 333551..333997 | + | 447 | WP_283182555.1 | carboxypeptidase regulatory-like domain-containing protein | - |
QFW87_RS01560 | 334072..334362 | + | 291 | WP_283182556.1 | YceK/YidQ family lipoprotein | - |
QFW87_RS01570 | 334701..334973 | - | 273 | WP_283182557.1 | oxidative damage protection protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15094.43 Da Isoelectric Point: 6.9687
>T282147 WP_283189655.1 NZ_CP125618:c329857-329450 [Pseudomonas sp. PMCC200344]
MIKYMLDTNICIFTIKNKPQIVREAFNRHNGQLCISAVTLMELFYGAEKSAAPEKNLAVIEGFVARLEVLPFDNEAAAHT
GMIRSELAKAGTPIGPYDHMIAGHARSRGFIVVTNNLREFERVPGLRAEDWVHPD
MIKYMLDTNICIFTIKNKPQIVREAFNRHNGQLCISAVTLMELFYGAEKSAAPEKNLAVIEGFVARLEVLPFDNEAAAHT
GMIRSELAKAGTPIGPYDHMIAGHARSRGFIVVTNNLREFERVPGLRAEDWVHPD
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|