Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 258899..259542 | Replicon | chromosome |
Accession | NZ_CP125618 | ||
Organism | Pseudomonas sp. PMCC200344 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0Q6Q0X4 |
Locus tag | QFW87_RS01170 | Protein ID | WP_046045491.1 |
Coordinates | 258899..259081 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QFW87_RS01175 | Protein ID | WP_283189619.1 |
Coordinates | 259078..259542 (+) | Length | 155 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFW87_RS01155 | 256093..258048 | + | 1956 | WP_283190869.1 | choline transporter BetT | - |
QFW87_RS01160 | 258057..258317 | - | 261 | WP_095127627.1 | hypothetical protein | - |
QFW87_RS01165 | 258453..258758 | - | 306 | WP_283184500.1 | SDR family oxidoreductase | - |
QFW87_RS01170 | 258899..259081 | + | 183 | WP_046045491.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QFW87_RS01175 | 259078..259542 | + | 465 | WP_283189619.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QFW87_RS01180 | 259714..260751 | + | 1038 | WP_283189620.1 | L-glyceraldehyde 3-phosphate reductase | - |
QFW87_RS01185 | 260803..261645 | - | 843 | WP_283182497.1 | taurine dioxygenase | - |
QFW87_RS01190 | 261706..262539 | - | 834 | WP_283189621.1 | taurine ABC transporter permease TauC | - |
QFW87_RS01195 | 262536..263330 | - | 795 | WP_283189622.1 | taurine ABC transporter ATP-binding subunit | - |
QFW87_RS01200 | 263346..264323 | - | 978 | WP_008149275.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 248529..259542 | 11013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6883.05 Da Isoelectric Point: 10.3203
>T282146 WP_046045491.1 NZ_CP125618:258899-259081 [Pseudomonas sp. PMCC200344]
MRSREMIRMIEEDGWYLVAVKGSHHQYKHPCKPGRVTIKHPDSDLPKGTINSILKQAGLK
MRSREMIRMIEEDGWYLVAVKGSHHQYKHPCKPGRVTIKHPDSDLPKGTINSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 155 a.a. Molecular weight: 16816.65 Da Isoelectric Point: 4.2687
>AT282146 WP_283189619.1 NZ_CP125618:259078-259542 [Pseudomonas sp. PMCC200344]
MSPDTGYESPERATSQEGISEMKFPVVLHKDADSEYGVIIPDVPGCFSAGGTVAQAFENVKEALSLHYEGLVADGDPLPQ
VHEIDAHLDNPDYAGGVWGVVEFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
MSPDTGYESPERATSQEGISEMKFPVVLHKDADSEYGVIIPDVPGCFSAGGTVAQAFENVKEALSLHYEGLVADGDPLPQ
VHEIDAHLDNPDYAGGVWGVVEFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
Download Length: 465 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|