Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5745392..5745978 | Replicon | chromosome |
Accession | NZ_CP125367 | ||
Organism | Pseudomonas aeruginosa strain ZY1710 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | QMK41_RS26770 | Protein ID | WP_003120987.1 |
Coordinates | 5745679..5745978 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | QMK41_RS26765 | Protein ID | WP_003448662.1 |
Coordinates | 5745392..5745682 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMK41_RS26750 (QMK41_26750) | 5740974..5742863 | + | 1890 | WP_196994395.1 | hypothetical protein | - |
QMK41_RS26755 (QMK41_26755) | 5742860..5744836 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
QMK41_RS26760 (QMK41_26760) | 5744977..5745321 | + | 345 | WP_016851612.1 | hypothetical protein | - |
QMK41_RS26765 (QMK41_26765) | 5745392..5745682 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
QMK41_RS26770 (QMK41_26770) | 5745679..5745978 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMK41_RS26775 (QMK41_26775) | 5746180..5747304 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
QMK41_RS26780 (QMK41_26780) | 5747304..5749013 | + | 1710 | WP_003099757.1 | PilN family type IVB pilus formation outer membrane protein | - |
QMK41_RS26785 (QMK41_26785) | 5749017..5750342 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
QMK41_RS26790 (QMK41_26790) | 5750332..5750865 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5717363..5804575 | 87212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T282144 WP_003120987.1 NZ_CP125367:c5745978-5745679 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|