Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 176108..176613 | Replicon | chromosome |
Accession | NZ_CP125365 | ||
Organism | Pseudomonas aeruginosa strain ZY36 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | QMK42_RS00820 | Protein ID | WP_003121619.1 |
Coordinates | 176108..176389 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | QMK42_RS00825 | Protein ID | WP_003112628.1 |
Coordinates | 176386..176613 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMK42_RS00795 (QMK42_00795) | 171359..172708 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
QMK42_RS00800 (QMK42_00800) | 172757..173443 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
QMK42_RS00805 (QMK42_00805) | 173544..174278 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
QMK42_RS00810 (QMK42_00810) | 174458..174868 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
QMK42_RS00815 (QMK42_00815) | 174900..175808 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
QMK42_RS00820 (QMK42_00820) | 176108..176389 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
QMK42_RS00825 (QMK42_00825) | 176386..176613 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QMK42_RS00830 (QMK42_00830) | 176789..177409 | - | 621 | WP_003101226.1 | hypothetical protein | - |
QMK42_RS00835 (QMK42_00835) | 177510..178010 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
QMK42_RS00840 (QMK42_00840) | 178083..178424 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
QMK42_RS00845 (QMK42_00845) | 178506..179933 | - | 1428 | WP_003083784.1 | GABA permease | - |
QMK42_RS00850 (QMK42_00850) | 180102..181595 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T282132 WP_003121619.1 NZ_CP125365:c176389-176108 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I707 |