Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 5744867..5745453 | Replicon | chromosome |
| Accession | NZ_CP125363 | ||
| Organism | Pseudomonas aeruginosa strain ZY156 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | QMK43_RS26775 | Protein ID | WP_003120987.1 |
| Coordinates | 5745154..5745453 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | QMK43_RS26770 | Protein ID | WP_003448662.1 |
| Coordinates | 5744867..5745157 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMK43_RS26755 (QMK43_26755) | 5740449..5742338 | + | 1890 | WP_196994395.1 | hypothetical protein | - |
| QMK43_RS26760 (QMK43_26760) | 5742335..5744311 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
| QMK43_RS26765 (QMK43_26765) | 5744452..5744796 | + | 345 | WP_016851612.1 | hypothetical protein | - |
| QMK43_RS26770 (QMK43_26770) | 5744867..5745157 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| QMK43_RS26775 (QMK43_26775) | 5745154..5745453 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMK43_RS26780 (QMK43_26780) | 5745655..5746779 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
| QMK43_RS26785 (QMK43_26785) | 5746779..5748488 | + | 1710 | WP_003099757.1 | PilN family type IVB pilus formation outer membrane protein | - |
| QMK43_RS26790 (QMK43_26790) | 5748492..5749817 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
| QMK43_RS26795 (QMK43_26795) | 5749807..5750340 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5716838..5804050 | 87212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T282130 WP_003120987.1 NZ_CP125363:c5745453-5745154 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|