Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5744843..5745429 | Replicon | chromosome |
Accession | NZ_CP125361 | ||
Organism | Pseudomonas aeruginosa strain ZY94 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | QMK40_RS26765 | Protein ID | WP_003120987.1 |
Coordinates | 5745130..5745429 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | QMK40_RS26760 | Protein ID | WP_003448662.1 |
Coordinates | 5744843..5745133 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMK40_RS26745 (QMK40_26745) | 5740425..5742314 | + | 1890 | WP_196994395.1 | hypothetical protein | - |
QMK40_RS26750 (QMK40_26750) | 5742311..5744287 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
QMK40_RS26755 (QMK40_26755) | 5744428..5744772 | + | 345 | WP_016851612.1 | hypothetical protein | - |
QMK40_RS26760 (QMK40_26760) | 5744843..5745133 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
QMK40_RS26765 (QMK40_26765) | 5745130..5745429 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMK40_RS26770 (QMK40_26770) | 5745631..5746755 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
QMK40_RS26775 (QMK40_26775) | 5746755..5748464 | + | 1710 | WP_003099757.1 | PilN family type IVB pilus formation outer membrane protein | - |
QMK40_RS26780 (QMK40_26780) | 5748468..5749793 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
QMK40_RS26785 (QMK40_26785) | 5749783..5750316 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5716814..5804026 | 87212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T282123 WP_003120987.1 NZ_CP125361:c5745429-5745130 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|