Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 29152..29744 Replicon plasmid pYUXJMC1
Accession NZ_CP125358
Organism Escherichia fergusonii strain XJ19MCE1

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag QKW25_RS24845 Protein ID WP_000520549.1
Coordinates 29496..29744 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag QKW25_RS24840 Protein ID WP_000681613.1
Coordinates 29152..29499 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKW25_RS24810 25157..25483 - 327 WP_000008647.1 TrbC/VirB2 family protein -
QKW25_RS24815 25497..26117 - 621 WP_000157549.1 lytic transglycosylase domain-containing protein -
QKW25_RS24820 26473..26688 - 216 WP_000760375.1 EexN family lipoprotein -
QKW25_RS24825 26685..26978 - 294 WP_060598542.1 sigma factor-like helix-turn-helix DNA-binding protein -
QKW25_RS24830 27055..28284 - 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
QKW25_RS24835 28288..28791 - 504 WP_000781813.1 relaxosome-coupling protein TaxA -
QKW25_RS24840 29152..29499 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QKW25_RS24845 29496..29744 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
QKW25_RS24850 30049..30399 - 351 WP_000854259.1 hypothetical protein -
QKW25_RS24855 30490..30789 - 300 WP_000650309.1 hypothetical protein -
QKW25_RS24860 31243..31470 - 228 WP_000801440.1 hypothetical protein -
QKW25_RS24865 31457..31708 - 252 WP_001230707.1 hypothetical protein -
QKW25_RS24870 31705..32247 - 543 WP_001083906.1 hypothetical protein -
QKW25_RS24875 32352..32867 - 516 WP_001025395.1 J domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..33309 33309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T282112 WP_000520549.1 NZ_CP125358:c29744-29496 [Escherichia fergusonii]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT282112 WP_000681613.1 NZ_CP125358:c29499-29152 [Escherichia fergusonii]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References