Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3888628..3889282 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F0JPE9 |
| Locus tag | QKW25_RS19140 | Protein ID | WP_000244774.1 |
| Coordinates | 3888628..3889035 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QKW25_RS19145 | Protein ID | WP_000354046.1 |
| Coordinates | 3889016..3889282 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS19120 (3884586) | 3884586..3886319 | - | 1734 | WP_196082055.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QKW25_RS19125 (3886325) | 3886325..3887035 | - | 711 | WP_196082056.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QKW25_RS19130 (3887059) | 3887059..3887955 | - | 897 | WP_000806645.1 | site-specific tyrosine recombinase XerD | - |
| QKW25_RS19135 (3888067) | 3888067..3888588 | + | 522 | WP_196082057.1 | flavodoxin FldB | - |
| QKW25_RS19140 (3888628) | 3888628..3889035 | - | 408 | WP_000244774.1 | protein YgfX | Toxin |
| QKW25_RS19145 (3889016) | 3889016..3889282 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QKW25_RS19150 (3889534) | 3889534..3890514 | + | 981 | WP_196082058.1 | tRNA-modifying protein YgfZ | - |
| QKW25_RS19155 (3890535) | 3890535..3891839 | + | 1305 | WP_196082059.1 | hypothetical protein | - |
| QKW25_RS19160 (3891836) | 3891836..3892303 | + | 468 | WP_181667840.1 | hypothetical protein | - |
| QKW25_RS19165 (3892334) | 3892334..3892993 | - | 660 | WP_000250283.1 | hemolysin III family protein | - |
| QKW25_RS19170 (3893157) | 3893157..3893468 | - | 312 | WP_001182962.1 | N(4)-acetylcytidine aminohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16078.05 Da Isoelectric Point: 11.2511
>T282097 WP_000244774.1 NZ_CP125351:c3889035-3888628 [Escherichia fergusonii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0L6ZX35 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |