Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3759868..3760702 Replicon chromosome
Accession NZ_CP125351
Organism Escherichia fergusonii strain XJ19MCE1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2X7CAN1
Locus tag QKW25_RS18580 Protein ID WP_039025883.1
Coordinates 3759868..3760245 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2X5LBZ2
Locus tag QKW25_RS18585 Protein ID WP_039025882.1
Coordinates 3760334..3760702 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKW25_RS18545 (3755463) 3755463..3756356 - 894 WP_283154480.1 LysR family transcriptional regulator -
QKW25_RS18550 (3756436) 3756436..3756753 + 318 Protein_3622 hypothetical protein -
QKW25_RS18555 (3756889) 3756889..3756990 + 102 WP_000662204.1 small membrane protein YkgR -
QKW25_RS18560 (3757198) 3757198..3758178 + 981 WP_283154368.1 IS5-like element ISKpn26 family transposase -
QKW25_RS18565 (3758326) 3758326..3759069 - 744 Protein_3625 DUF4942 domain-containing protein -
QKW25_RS18570 (3759166) 3759166..3759363 - 198 WP_000772024.1 DUF957 domain-containing protein -
QKW25_RS18575 (3759383) 3759383..3759871 - 489 Protein_3627 DUF5983 family protein -
QKW25_RS18580 (3759868) 3759868..3760245 - 378 WP_039025883.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QKW25_RS18585 (3760334) 3760334..3760702 - 369 WP_039025882.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QKW25_RS18590 (3760752) 3760752..3761396 - 645 WP_283154481.1 antitoxin of toxin-antitoxin stability system -
QKW25_RS18595 (3761411) 3761411..3761632 - 222 WP_000692353.1 DUF987 domain-containing protein -
QKW25_RS18600 (3761701) 3761701..3762177 - 477 WP_181673077.1 RadC family protein -
QKW25_RS18605 (3762192) 3762192..3762677 - 486 WP_000214317.1 antirestriction protein -
QKW25_RS18610 (3762768) 3762768..3763586 - 819 Protein_3634 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 3757198..3758178 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14176.22 Da        Isoelectric Point: 7.8523

>T282095 WP_039025883.1 NZ_CP125351:c3760245-3759868 [Escherichia fergusonii]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQLEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13792.52 Da        Isoelectric Point: 5.9582

>AT282095 WP_039025882.1 NZ_CP125351:c3760702-3760334 [Escherichia fergusonii]
VSDTFHETNYPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2X7CAN1

Antitoxin

Source ID Structure
AlphaFold DB A0A2X5LBZ2

References