Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3759868..3760702 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2X7CAN1 |
| Locus tag | QKW25_RS18580 | Protein ID | WP_039025883.1 |
| Coordinates | 3759868..3760245 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2X5LBZ2 |
| Locus tag | QKW25_RS18585 | Protein ID | WP_039025882.1 |
| Coordinates | 3760334..3760702 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS18545 (3755463) | 3755463..3756356 | - | 894 | WP_283154480.1 | LysR family transcriptional regulator | - |
| QKW25_RS18550 (3756436) | 3756436..3756753 | + | 318 | Protein_3622 | hypothetical protein | - |
| QKW25_RS18555 (3756889) | 3756889..3756990 | + | 102 | WP_000662204.1 | small membrane protein YkgR | - |
| QKW25_RS18560 (3757198) | 3757198..3758178 | + | 981 | WP_283154368.1 | IS5-like element ISKpn26 family transposase | - |
| QKW25_RS18565 (3758326) | 3758326..3759069 | - | 744 | Protein_3625 | DUF4942 domain-containing protein | - |
| QKW25_RS18570 (3759166) | 3759166..3759363 | - | 198 | WP_000772024.1 | DUF957 domain-containing protein | - |
| QKW25_RS18575 (3759383) | 3759383..3759871 | - | 489 | Protein_3627 | DUF5983 family protein | - |
| QKW25_RS18580 (3759868) | 3759868..3760245 | - | 378 | WP_039025883.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QKW25_RS18585 (3760334) | 3760334..3760702 | - | 369 | WP_039025882.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QKW25_RS18590 (3760752) | 3760752..3761396 | - | 645 | WP_283154481.1 | antitoxin of toxin-antitoxin stability system | - |
| QKW25_RS18595 (3761411) | 3761411..3761632 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| QKW25_RS18600 (3761701) | 3761701..3762177 | - | 477 | WP_181673077.1 | RadC family protein | - |
| QKW25_RS18605 (3762192) | 3762192..3762677 | - | 486 | WP_000214317.1 | antirestriction protein | - |
| QKW25_RS18610 (3762768) | 3762768..3763586 | - | 819 | Protein_3634 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3757198..3758178 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14176.22 Da Isoelectric Point: 7.8523
>T282095 WP_039025883.1 NZ_CP125351:c3760245-3759868 [Escherichia fergusonii]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQLEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQLEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13792.52 Da Isoelectric Point: 5.9582
>AT282095 WP_039025882.1 NZ_CP125351:c3760702-3760334 [Escherichia fergusonii]
VSDTFHETNYPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTFHETNYPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X7CAN1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X5LBZ2 |