Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3628251..3628870 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | QKW25_RS17965 | Protein ID | WP_001280991.1 |
| Coordinates | 3628652..3628870 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B7LLQ9 |
| Locus tag | QKW25_RS17960 | Protein ID | WP_000344803.1 |
| Coordinates | 3628251..3628625 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS17950 (3623383) | 3623383..3624576 | + | 1194 | WP_196082219.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QKW25_RS17955 (3624599) | 3624599..3627748 | + | 3150 | WP_196082218.1 | efflux RND transporter permease AcrB | - |
| QKW25_RS17960 (3628251) | 3628251..3628625 | + | 375 | WP_000344803.1 | Hha toxicity modulator TomB | Antitoxin |
| QKW25_RS17965 (3628652) | 3628652..3628870 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| QKW25_RS17970 (3629367) | 3629367..3629837 | + | 471 | WP_002431406.1 | YlaC family protein | - |
| QKW25_RS17975 (3629976) | 3629976..3631526 | + | 1551 | WP_283154465.1 | EAL domain-containing protein | - |
| QKW25_RS17980 (3631568) | 3631568..3631921 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QKW25_RS17990 (3632300) | 3632300..3632611 | + | 312 | WP_196082216.1 | MGMT family protein | - |
| QKW25_RS17995 (3632642) | 3632642..3633214 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T282094 WP_001280991.1 NZ_CP125351:3628652-3628870 [Escherichia fergusonii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14525.33 Da Isoelectric Point: 4.8989
>AT282094 WP_000344803.1 NZ_CP125351:3628251-3628625 [Escherichia fergusonii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|