Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2789543..2790378 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | QKW25_RS13680 | Protein ID | WP_000854821.1 |
| Coordinates | 2789543..2789920 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QKW25_RS13685 | Protein ID | WP_063266316.1 |
| Coordinates | 2790010..2790378 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS13640 (2784802) | 2784802..2785284 | - | 483 | WP_283154386.1 | DUF1097 domain-containing protein | - |
| QKW25_RS13645 (2785385) | 2785385..2785939 | - | 555 | WP_001001886.1 | molecular chaperone | - |
| QKW25_RS13650 (2785963) | 2785963..2786700 | - | 738 | WP_000283681.1 | phosphatase | - |
| QKW25_RS13655 (2786787) | 2786787..2787725 | - | 939 | WP_000353197.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QKW25_RS13665 (2788158) | 2788158..2789039 | - | 882 | WP_283154387.1 | DUF4942 domain-containing protein | - |
| QKW25_RS13670 (2789124) | 2789124..2789321 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| QKW25_RS13675 (2789349) | 2789349..2789546 | - | 198 | Protein_2672 | DUF5983 family protein | - |
| QKW25_RS13680 (2789543) | 2789543..2789920 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QKW25_RS13685 (2790010) | 2790010..2790378 | - | 369 | WP_063266316.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QKW25_RS13690 (2790428) | 2790428..2791072 | - | 645 | WP_059252084.1 | hypothetical protein | - |
| QKW25_RS13695 (2791087) | 2791087..2791308 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| QKW25_RS13700 (2791377) | 2791377..2791853 | - | 477 | WP_181673077.1 | RadC family protein | - |
| QKW25_RS13705 (2791868) | 2791868..2792353 | - | 486 | WP_000214317.1 | antirestriction protein | - |
| QKW25_RS13710 (2792444) | 2792444..2793262 | - | 819 | WP_139532884.1 | DUF932 domain-containing protein | - |
| QKW25_RS13715 (2793362) | 2793362..2793595 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QKW25_RS13720 (2793674) | 2793674..2794129 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgE / csgF / csgG | 2782578..2792353 | 9775 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T282091 WP_000854821.1 NZ_CP125351:c2789920-2789543 [Escherichia fergusonii]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13634.39 Da Isoelectric Point: 6.7386
>AT282091 WP_063266316.1 NZ_CP125351:c2790378-2790010 [Escherichia fergusonii]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|