Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2789543..2790378 Replicon chromosome
Accession NZ_CP125351
Organism Escherichia fergusonii strain XJ19MCE1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QKW25_RS13680 Protein ID WP_000854821.1
Coordinates 2789543..2789920 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QKW25_RS13685 Protein ID WP_063266316.1
Coordinates 2790010..2790378 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKW25_RS13640 (2784802) 2784802..2785284 - 483 WP_283154386.1 DUF1097 domain-containing protein -
QKW25_RS13645 (2785385) 2785385..2785939 - 555 WP_001001886.1 molecular chaperone -
QKW25_RS13650 (2785963) 2785963..2786700 - 738 WP_000283681.1 phosphatase -
QKW25_RS13655 (2786787) 2786787..2787725 - 939 WP_000353197.1 glyoxylate/hydroxypyruvate reductase GhrA -
QKW25_RS13665 (2788158) 2788158..2789039 - 882 WP_283154387.1 DUF4942 domain-containing protein -
QKW25_RS13670 (2789124) 2789124..2789321 - 198 WP_023563519.1 DUF957 domain-containing protein -
QKW25_RS13675 (2789349) 2789349..2789546 - 198 Protein_2672 DUF5983 family protein -
QKW25_RS13680 (2789543) 2789543..2789920 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QKW25_RS13685 (2790010) 2790010..2790378 - 369 WP_063266316.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QKW25_RS13690 (2790428) 2790428..2791072 - 645 WP_059252084.1 hypothetical protein -
QKW25_RS13695 (2791087) 2791087..2791308 - 222 WP_000692353.1 DUF987 domain-containing protein -
QKW25_RS13700 (2791377) 2791377..2791853 - 477 WP_181673077.1 RadC family protein -
QKW25_RS13705 (2791868) 2791868..2792353 - 486 WP_000214317.1 antirestriction protein -
QKW25_RS13710 (2792444) 2792444..2793262 - 819 WP_139532884.1 DUF932 domain-containing protein -
QKW25_RS13715 (2793362) 2793362..2793595 - 234 WP_001119729.1 DUF905 family protein -
QKW25_RS13720 (2793674) 2793674..2794129 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgE / csgF / csgG 2782578..2792353 9775


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T282091 WP_000854821.1 NZ_CP125351:c2789920-2789543 [Escherichia fergusonii]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13634.39 Da        Isoelectric Point: 6.7386

>AT282091 WP_063266316.1 NZ_CP125351:c2790378-2790010 [Escherichia fergusonii]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References