Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1448397..1449022 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | QKW25_RS07000 | Protein ID | WP_000911329.1 |
| Coordinates | 1448624..1449022 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | QKW25_RS06995 | Protein ID | WP_000450524.1 |
| Coordinates | 1448397..1448624 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS06970 (1444200) | 1444200..1444670 | - | 471 | WP_001068688.1 | thioredoxin-dependent thiol peroxidase | - |
| QKW25_RS06975 (1444670) | 1444670..1445242 | - | 573 | WP_000189057.1 | glycine cleavage system transcriptional repressor | - |
| QKW25_RS06980 (1445389) | 1445389..1446267 | + | 879 | WP_000494011.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| QKW25_RS06985 (1446284) | 1446284..1447318 | + | 1035 | WP_196081269.1 | outer membrane protein assembly factor BamC | - |
| QKW25_RS06990 (1447530) | 1447530..1448243 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| QKW25_RS06995 (1448397) | 1448397..1448624 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QKW25_RS07000 (1448624) | 1448624..1449022 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QKW25_RS07005 (1449169) | 1449169..1450032 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| QKW25_RS07010 (1450047) | 1450047..1452062 | + | 2016 | WP_196081268.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| QKW25_RS07015 (1452136) | 1452136..1452834 | + | 699 | WP_000679801.1 | esterase | - |
| QKW25_RS07020 (1452927) | 1452927..1453127 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T282085 WP_000911329.1 NZ_CP125351:1448624-1449022 [Escherichia fergusonii]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |