Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 792008..792558 Replicon chromosome
Accession NZ_CP125351
Organism Escherichia fergusonii strain XJ19MCE1

Toxin (Protein)


Gene name ccdB Uniprot ID F0JPU1
Locus tag QKW25_RS03960 Protein ID WP_001160963.1
Coordinates 792244..792558 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QKW25_RS03955 Protein ID WP_000125566.1
Coordinates 792008..792241 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKW25_RS03930 (787080) 787080..787367 + 288 WP_000203741.1 ferredoxin-like protein FixX -
QKW25_RS03935 (787426) 787426..788757 + 1332 WP_283154618.1 MFS transporter -
QKW25_RS03940 (788865) 788865..789395 + 531 WP_000600701.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QKW25_RS03945 (789388) 789388..791250 + 1863 WP_283154619.1 glutathione-regulated potassium-efflux system protein KefC -
QKW25_RS03950 (791443) 791443..791922 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QKW25_RS03955 (792008) 792008..792241 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QKW25_RS03960 (792244) 792244..792558 + 315 WP_001160963.1 CcdB family protein Toxin
QKW25_RS03965 (792555) 792555..793403 - 849 WP_000257189.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QKW25_RS03970 (793410) 793410..793787 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QKW25_RS03975 (793790) 793790..794611 - 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QKW25_RS03980 (794608) 794608..795597 - 990 WP_000241252.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QKW25_RS03985 (795597) 795597..796883 - 1287 WP_196081222.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11722.70 Da        Isoelectric Point: 8.0666

>T282084 WP_001160963.1 NZ_CP125351:792244-792558 [Escherichia fergusonii]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSHIRPPERLNPILLLVDGKEYVLMTHETATVPVNTLG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT282084 WP_000125566.1 NZ_CP125351:792008-792241 [Escherichia fergusonii]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB F0JPU1

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References