Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 561618..562140 | Replicon | chromosome |
Accession | NZ_CP125351 | ||
Organism | Escherichia fergusonii strain XJ19MCE1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QKW25_RS02690 | Protein ID | WP_196082280.1 |
Coordinates | 561850..562140 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QKW25_RS02685 | Protein ID | WP_196082281.1 |
Coordinates | 561618..561860 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QKW25_RS02665 (557536) | 557536..558909 | + | 1374 | WP_001219809.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
QKW25_RS02670 (558992) | 558992..559543 | - | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
QKW25_RS02675 (559636) | 559636..560988 | + | 1353 | WP_001162171.1 | metalloprotease PmbA | - |
QKW25_RS02680 (561041) | 561041..561427 | + | 387 | WP_196082282.1 | cytochrome b562 | - |
QKW25_RS02685 (561618) | 561618..561860 | + | 243 | WP_196082281.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QKW25_RS02690 (561850) | 561850..562140 | + | 291 | WP_196082280.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QKW25_RS02695 (562141) | 562141..562605 | - | 465 | WP_001106235.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QKW25_RS02700 (562763) | 562763..564901 | - | 2139 | WP_000187805.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QKW25_RS02705 (565295) | 565295..566950 | - | 1656 | WP_283154598.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11293.24 Da Isoelectric Point: 10.4221
>T282081 WP_196082280.1 NZ_CP125351:561850-562140 [Escherichia fergusonii]
MNYELAFDPRALKEWQKLGVTVREQFKKKLGDVLKRPRNPSAKLRDLPDCYKIKLRTLGYRRVYQVNDKELLVLVIAIGK
RENSAVYEDVTKRLGE
MNYELAFDPRALKEWQKLGVTVREQFKKKLGDVLKRPRNPSAKLRDLPDCYKIKLRTLGYRRVYQVNDKELLVLVIAIGK
RENSAVYEDVTKRLGE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|