Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4190966..4191585 | Replicon | chromosome |
Accession | NZ_CP125349 | ||
Organism | Klebsiella pneumoniae strain WYKP594 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QJR22_RS22275 | Protein ID | WP_002892050.1 |
Coordinates | 4191367..4191585 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | QJR22_RS22270 | Protein ID | WP_002892066.1 |
Coordinates | 4190966..4191340 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJR22_RS22260 (QJR22_22265) | 4186118..4187311 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QJR22_RS22265 (QJR22_22270) | 4187334..4190480 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QJR22_RS22270 (QJR22_22275) | 4190966..4191340 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
QJR22_RS22275 (QJR22_22280) | 4191367..4191585 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QJR22_RS22280 (QJR22_22285) | 4191744..4192310 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
QJR22_RS22285 (QJR22_22290) | 4192282..4192422 | - | 141 | WP_004147370.1 | hypothetical protein | - |
QJR22_RS22290 (QJR22_22295) | 4192443..4192913 | + | 471 | WP_002892026.1 | YlaC family protein | - |
QJR22_RS22295 (QJR22_22300) | 4192888..4194339 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
QJR22_RS22300 (QJR22_22305) | 4194440..4195138 | + | 699 | WP_002892021.1 | GNAT family protein | - |
QJR22_RS22305 (QJR22_22310) | 4195135..4195275 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
QJR22_RS22310 (QJR22_22315) | 4195275..4195538 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T282074 WP_002892050.1 NZ_CP125349:4191367-4191585 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT282074 WP_002892066.1 NZ_CP125349:4190966-4191340 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |