Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 58721..59301 | Replicon | plasmid pWYKP594-3 |
| Accession | NZ_CP125347 | ||
| Organism | Klebsiella pneumoniae strain WYKP594 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8J3DTL7 |
| Locus tag | QJR22_RS00800 | Protein ID | WP_071177730.1 |
| Coordinates | 58721..59035 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2X1PRM1 |
| Locus tag | QJR22_RS00805 | Protein ID | WP_000093040.1 |
| Coordinates | 59023..59301 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR22_RS00775 (QJR22_00775) | 54665..56629 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
| QJR22_RS00780 (QJR22_00780) | 56629..57360 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
| QJR22_RS00785 (QJR22_00785) | 57367..57897 | + | 531 | WP_071177729.1 | hypothetical protein | - |
| QJR22_RS00790 (QJR22_00790) | 57924..58103 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
| QJR22_RS00795 (QJR22_00795) | 58129..58557 | - | 429 | WP_001140599.1 | hypothetical protein | - |
| QJR22_RS00800 (QJR22_00800) | 58721..59035 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJR22_RS00805 (QJR22_00805) | 59023..59301 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| QJR22_RS00810 (QJR22_00810) | 59342..59485 | - | 144 | WP_283146564.1 | hypothetical protein | - |
| QJR22_RS00815 (QJR22_00815) | 59491..60196 | - | 706 | Protein_83 | IS6-like element IS26 family transposase | - |
| QJR22_RS00820 (QJR22_00820) | 60259..60603 | + | 345 | Protein_84 | replication protein | - |
| QJR22_RS00825 (QJR22_00825) | 61137..61415 | + | 279 | WP_013213990.1 | hypothetical protein | - |
| QJR22_RS00830 (QJR22_00830) | 61526..61951 | + | 426 | WP_013213989.1 | antirestriction protein | - |
| QJR22_RS00835 (QJR22_00835) | 62079..62234 | + | 156 | WP_013213988.1 | hypothetical protein | - |
| QJR22_RS00840 (QJR22_00840) | 62280..62576 | + | 297 | WP_013213987.1 | transcriptional regulator | - |
| QJR22_RS00845 (QJR22_00845) | 62680..63561 | + | 882 | Protein_89 | IS1182-like element ISKpn6 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 | - | 1..73344 | 73344 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T282064 WP_071177730.1 NZ_CP125347:c59035-58721 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|