Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 58721..59301 Replicon plasmid pWYKP594-3
Accession NZ_CP125347
Organism Klebsiella pneumoniae strain WYKP594

Toxin (Protein)


Gene name parE Uniprot ID A0A8J3DTL7
Locus tag QJR22_RS00800 Protein ID WP_071177730.1
Coordinates 58721..59035 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2X1PRM1
Locus tag QJR22_RS00805 Protein ID WP_000093040.1
Coordinates 59023..59301 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR22_RS00775 (QJR22_00775) 54665..56629 + 1965 WP_071177727.1 TraM recognition domain-containing protein -
QJR22_RS00780 (QJR22_00780) 56629..57360 + 732 WP_071177728.1 MobC family replication-relaxation protein -
QJR22_RS00785 (QJR22_00785) 57367..57897 + 531 WP_071177729.1 hypothetical protein -
QJR22_RS00790 (QJR22_00790) 57924..58103 - 180 WP_000165970.1 Rop family plasmid primer RNA-binding protein -
QJR22_RS00795 (QJR22_00795) 58129..58557 - 429 WP_001140599.1 hypothetical protein -
QJR22_RS00800 (QJR22_00800) 58721..59035 - 315 WP_071177730.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QJR22_RS00805 (QJR22_00805) 59023..59301 - 279 WP_000093040.1 CopG family ribbon-helix-helix protein Antitoxin
QJR22_RS00810 (QJR22_00810) 59342..59485 - 144 WP_283146564.1 hypothetical protein -
QJR22_RS00815 (QJR22_00815) 59491..60196 - 706 Protein_83 IS6-like element IS26 family transposase -
QJR22_RS00820 (QJR22_00820) 60259..60603 + 345 Protein_84 replication protein -
QJR22_RS00825 (QJR22_00825) 61137..61415 + 279 WP_013213990.1 hypothetical protein -
QJR22_RS00830 (QJR22_00830) 61526..61951 + 426 WP_013213989.1 antirestriction protein -
QJR22_RS00835 (QJR22_00835) 62079..62234 + 156 WP_013213988.1 hypothetical protein -
QJR22_RS00840 (QJR22_00840) 62280..62576 + 297 WP_013213987.1 transcriptional regulator -
QJR22_RS00845 (QJR22_00845) 62680..63561 + 882 Protein_89 IS1182-like element ISKpn6 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 - 1..73344 73344


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-96)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11805.73 Da        Isoelectric Point: 9.8324

>T282064 WP_071177730.1 NZ_CP125347:c59035-58721 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL

Download         Length: 315 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10709.73 Da        Isoelectric Point: 4.7561

>AT282064 WP_000093040.1 NZ_CP125347:c59301-59023 [Klebsiella pneumoniae]
MSSATSIRLDEELKDRLKTLADDRHRSAHALMLEAITEYIDREEKRSQYLRDGQAAWQHYQETGLHLTAEEAEAWISTWG
TENEQDAPPCHR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2X1PRM1

References