Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 5182..5825 | Replicon | plasmid pWYKP594-3 |
| Accession | NZ_CP125347 | ||
| Organism | Klebsiella pneumoniae strain WYKP594 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | QJR22_RS00425 | Protein ID | WP_001044770.1 |
| Coordinates | 5182..5598 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | QJR22_RS00430 | Protein ID | WP_001261282.1 |
| Coordinates | 5595..5825 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR22_RS00405 (QJR22_00405) | 1285..1557 | - | 273 | Protein_1 | transposase | - |
| QJR22_RS00415 (QJR22_00415) | 2539..3561 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| QJR22_RS00420 (QJR22_00420) | 3546..5108 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| QJR22_RS00425 (QJR22_00425) | 5182..5598 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJR22_RS00430 (QJR22_00430) | 5595..5825 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJR22_RS00435 (QJR22_00435) | 5782..6243 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| QJR22_RS00440 (QJR22_00440) | 6404..7348 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| QJR22_RS00445 (QJR22_00445) | 7385..7777 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| QJR22_RS00450 (QJR22_00450) | 7835..8356 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| QJR22_RS00455 (QJR22_00455) | 8402..8605 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| QJR22_RS00460 (QJR22_00460) | 8635..9639 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| QJR22_RS00465 (QJR22_00465) | 9823..10602 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 | - | 1..73344 | 73344 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T282063 WP_001044770.1 NZ_CP125347:c5598-5182 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |