Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 130198..130868 Replicon plasmid pWYKP589-1
Accession NZ_CP125344
Organism Klebsiella pneumoniae strain WYKP589

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag QJR23_RS29035 Protein ID WP_004213072.1
Coordinates 130425..130868 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag QJR23_RS29030 Protein ID WP_004213073.1
Coordinates 130198..130428 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR23_RS29000 (QJR23_29000) 125383..126162 - 780 WP_004213560.1 site-specific integrase -
QJR23_RS29005 (QJR23_29005) 126159..126980 - 822 WP_004213562.1 hypothetical protein -
QJR23_RS29010 (QJR23_29010) 127480..127743 - 264 Protein_128 hypothetical protein -
QJR23_RS29015 (QJR23_29015) 127952..128158 + 207 WP_004213077.1 hypothetical protein -
QJR23_RS29020 (QJR23_29020) 128148..128441 - 294 WP_004213076.1 hypothetical protein -
QJR23_RS29025 (QJR23_29025) 128457..129590 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
QJR23_RS29030 (QJR23_29030) 130198..130428 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QJR23_RS29035 (QJR23_29035) 130425..130868 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
QJR23_RS29040 (QJR23_29040) 131017..131268 + 252 WP_186987481.1 hypothetical protein -
QJR23_RS29045 (QJR23_29045) 131291..131595 - 305 Protein_135 transposase -
QJR23_RS29050 (QJR23_29050) 132012..132647 + 636 Protein_136 mucoid phenotype regulator RmpA2 -
QJR23_RS29055 (QJR23_29055) 133165..133568 - 404 Protein_137 GAF domain-containing protein -
QJR23_RS29060 (QJR23_29060) 133659..134579 - 921 WP_004213934.1 DUF1471 domain-containing protein -
QJR23_RS29065 (QJR23_29065) 134628..135119 - 492 WP_011251327.1 DM13 domain-containing protein -
QJR23_RS29070 (QJR23_29070) 135182..135457 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..217869 217869


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T282052 WP_004213072.1 NZ_CP125344:130425-130868 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT282052 WP_004213073.1 NZ_CP125344:130198-130428 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References