Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 130198..130868 | Replicon | plasmid pWYKP589-1 |
| Accession | NZ_CP125344 | ||
| Organism | Klebsiella pneumoniae strain WYKP589 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | QJR23_RS29035 | Protein ID | WP_004213072.1 |
| Coordinates | 130425..130868 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | QJR23_RS29030 | Protein ID | WP_004213073.1 |
| Coordinates | 130198..130428 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR23_RS29000 (QJR23_29000) | 125383..126162 | - | 780 | WP_004213560.1 | site-specific integrase | - |
| QJR23_RS29005 (QJR23_29005) | 126159..126980 | - | 822 | WP_004213562.1 | hypothetical protein | - |
| QJR23_RS29010 (QJR23_29010) | 127480..127743 | - | 264 | Protein_128 | hypothetical protein | - |
| QJR23_RS29015 (QJR23_29015) | 127952..128158 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| QJR23_RS29020 (QJR23_29020) | 128148..128441 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| QJR23_RS29025 (QJR23_29025) | 128457..129590 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| QJR23_RS29030 (QJR23_29030) | 130198..130428 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJR23_RS29035 (QJR23_29035) | 130425..130868 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJR23_RS29040 (QJR23_29040) | 131017..131268 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| QJR23_RS29045 (QJR23_29045) | 131291..131595 | - | 305 | Protein_135 | transposase | - |
| QJR23_RS29050 (QJR23_29050) | 132012..132647 | + | 636 | Protein_136 | mucoid phenotype regulator RmpA2 | - |
| QJR23_RS29055 (QJR23_29055) | 133165..133568 | - | 404 | Protein_137 | GAF domain-containing protein | - |
| QJR23_RS29060 (QJR23_29060) | 133659..134579 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| QJR23_RS29065 (QJR23_29065) | 134628..135119 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| QJR23_RS29070 (QJR23_29070) | 135182..135457 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..217869 | 217869 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T282052 WP_004213072.1 NZ_CP125344:130425-130868 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|