Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4191793..4192412 Replicon chromosome
Accession NZ_CP125343
Organism Klebsiella pneumoniae strain WYKP589

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QJR23_RS22260 Protein ID WP_002892050.1
Coordinates 4192194..4192412 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QJR23_RS22255 Protein ID WP_002892066.1
Coordinates 4191793..4192167 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR23_RS22245 (QJR23_22245) 4186945..4188138 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QJR23_RS22250 (QJR23_22250) 4188161..4191307 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
QJR23_RS22255 (QJR23_22255) 4191793..4192167 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QJR23_RS22260 (QJR23_22260) 4192194..4192412 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QJR23_RS22265 (QJR23_22265) 4192571..4193137 + 567 WP_002892030.1 maltose O-acetyltransferase -
QJR23_RS22270 (QJR23_22270) 4193109..4193249 - 141 WP_004147370.1 hypothetical protein -
QJR23_RS22275 (QJR23_22275) 4193270..4193740 + 471 WP_002892026.1 YlaC family protein -
QJR23_RS22280 (QJR23_22280) 4193715..4195166 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QJR23_RS22285 (QJR23_22285) 4195267..4195965 + 699 WP_002892021.1 GNAT family protein -
QJR23_RS22290 (QJR23_22290) 4195962..4196102 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QJR23_RS22295 (QJR23_22295) 4196102..4196365 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T282047 WP_002892050.1 NZ_CP125343:4192194-4192412 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT282047 WP_002892066.1 NZ_CP125343:4191793-4192167 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References