Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 103042..103685 Replicon plasmid pWYKP589-2
Accession NZ_CP125342
Organism Klebsiella pneumoniae strain WYKP589

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag QJR23_RS01305 Protein ID WP_001044770.1
Coordinates 103269..103685 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QJR23_RS01300 Protein ID WP_001261282.1
Coordinates 103042..103272 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR23_RS01265 (98265) 98265..99044 - 780 WP_013214009.1 site-specific integrase -
QJR23_RS01270 (99228) 99228..100232 - 1005 WP_011977814.1 hypothetical protein -
QJR23_RS01275 (100262) 100262..100465 - 204 WP_011977813.1 hypothetical protein -
QJR23_RS01280 (100511) 100511..101032 - 522 WP_013214008.1 hypothetical protein -
QJR23_RS01285 (101090) 101090..101482 - 393 WP_011977811.1 hypothetical protein -
QJR23_RS01290 (101519) 101519..102463 - 945 WP_011977810.1 hypothetical protein -
QJR23_RS01295 (102624) 102624..103085 - 462 WP_014343465.1 hypothetical protein -
QJR23_RS01300 (103042) 103042..103272 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QJR23_RS01305 (103269) 103269..103685 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
QJR23_RS01310 (103759) 103759..105321 + 1563 WP_004206609.1 AAA family ATPase -
QJR23_RS01315 (105306) 105306..106328 + 1023 WP_000361404.1 helicase UvrD -
QJR23_RS01320 (106584) 106584..107281 + 698 WP_223174630.1 IS1 family transposase -
QJR23_RS01325 (107310) 107310..107582 + 273 Protein_148 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B - 1..110599 110599


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T282037 WP_001044770.1 NZ_CP125342:103269-103685 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT282037 WP_001261282.1 NZ_CP125342:103042-103272 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References