Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 30598..31241 | Replicon | plasmid pWYKP586-2 |
| Accession | NZ_CP125336 | ||
| Organism | Klebsiella pneumoniae strain WYKP586 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | QJR21_RS28835 | Protein ID | WP_001044770.1 |
| Coordinates | 30598..31014 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | QJR21_RS28840 | Protein ID | WP_001261282.1 |
| Coordinates | 31011..31241 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR21_RS28815 (26701) | 26701..26973 | - | 273 | Protein_33 | transposase | - |
| QJR21_RS28825 (27955) | 27955..28977 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| QJR21_RS28830 (28962) | 28962..30524 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| QJR21_RS28835 (30598) | 30598..31014 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJR21_RS28840 (31011) | 31011..31241 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJR21_RS28845 (31198) | 31198..31659 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| QJR21_RS28850 (31820) | 31820..32764 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| QJR21_RS28855 (32801) | 32801..33193 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| QJR21_RS28860 (33251) | 33251..33772 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| QJR21_RS28865 (33818) | 33818..34021 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| QJR21_RS28870 (34051) | 34051..35055 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| QJR21_RS28875 (35239) | 35239..36018 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaSHV-12 / blaKPC-2 | - | 1..110449 | 110449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T282022 WP_001044770.1 NZ_CP125336:c31014-30598 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |