Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 213539..214449 Replicon plasmid unnamed1
Accession NZ_CP125335
Organism Klebsiella pneumoniae strain WYKP586

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag QJR21_RS28135 Protein ID WP_004026354.1
Coordinates 213979..214449 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag QJR21_RS28130 Protein ID WP_004026357.1
Coordinates 213539..213982 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR21_RS28100 (QJR21_28100) 208574..208975 + 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -
QJR21_RS28105 (QJR21_28105) 209048..209950 + 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
QJR21_RS28110 (QJR21_28110) 210093..210314 - 222 WP_004213615.1 hypothetical protein -
QJR21_RS28115 (QJR21_28115) 210376..211683 - 1308 Protein_223 FepA family TonB-dependent siderophore receptor -
QJR21_RS28120 (QJR21_28120) 211749..212729 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
QJR21_RS28125 (QJR21_28125) 212935..213438 + 504 Protein_225 DUF4113 domain-containing protein -
QJR21_RS28130 (QJR21_28130) 213539..213982 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
QJR21_RS28135 (QJR21_28135) 213979..214449 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
QJR21_RS28140 (QJR21_28140) 214598..215295 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
QJR21_RS28145 (QJR21_28145) 216681..217331 - 651 WP_068893702.1 DUF1173 family protein -
QJR21_RS28150 (QJR21_28150) 217364..217630 - 267 WP_223175074.1 DUF1173 family protein -
QJR21_RS28155 (QJR21_28155) 217808..218302 + 495 WP_004212794.1 thermonuclease family protein -
QJR21_RS28160 (QJR21_28160) 218639..219037 + 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA2 / sul2 / tet(A) / blaLAP-2 / qnrS1 rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..302246 302246
- inside IScluster/Tn - - 211749..220488 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T282021 WP_004026354.1 NZ_CP125335:213979-214449 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT282021 WP_004026357.1 NZ_CP125335:213539-213982 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References