Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 174915..175585 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP125335 | ||
| Organism | Klebsiella pneumoniae strain WYKP586 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | QJR21_RS27895 | Protein ID | WP_004213072.1 |
| Coordinates | 175142..175585 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | QJR21_RS27890 | Protein ID | WP_004213073.1 |
| Coordinates | 174915..175145 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR21_RS27865 (QJR21_27865) | 170100..170879 | - | 780 | WP_004213560.1 | site-specific integrase | - |
| QJR21_RS27870 (QJR21_27870) | 170876..171697 | - | 822 | WP_004213562.1 | hypothetical protein | - |
| QJR21_RS27875 (QJR21_27875) | 172669..172875 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| QJR21_RS27880 (QJR21_27880) | 172865..173158 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| QJR21_RS27885 (QJR21_27885) | 173174..174307 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| QJR21_RS27890 (QJR21_27890) | 174915..175145 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJR21_RS27895 (QJR21_27895) | 175142..175585 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJR21_RS27900 (QJR21_27900) | 175734..175985 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| QJR21_RS27905 (QJR21_27905) | 176008..176312 | - | 305 | Protein_181 | transposase | - |
| QJR21_RS27910 (QJR21_27910) | 176729..177364 | + | 636 | Protein_182 | mucoid phenotype regulator RmpA2 | - |
| QJR21_RS27915 (QJR21_27915) | 177882..178285 | - | 404 | Protein_183 | GAF domain-containing protein | - |
| QJR21_RS27920 (QJR21_27920) | 178376..179296 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| QJR21_RS27925 (QJR21_27925) | 179345..179836 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| QJR21_RS27930 (QJR21_27930) | 179899..180174 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA2 / sul2 / tet(A) / blaLAP-2 / qnrS1 | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..302246 | 302246 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T282020 WP_004213072.1 NZ_CP125335:175142-175585 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|