Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 174915..175585 Replicon plasmid unnamed1
Accession NZ_CP125335
Organism Klebsiella pneumoniae strain WYKP586

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag QJR21_RS27895 Protein ID WP_004213072.1
Coordinates 175142..175585 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag QJR21_RS27890 Protein ID WP_004213073.1
Coordinates 174915..175145 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR21_RS27865 (QJR21_27865) 170100..170879 - 780 WP_004213560.1 site-specific integrase -
QJR21_RS27870 (QJR21_27870) 170876..171697 - 822 WP_004213562.1 hypothetical protein -
QJR21_RS27875 (QJR21_27875) 172669..172875 + 207 WP_004213077.1 hypothetical protein -
QJR21_RS27880 (QJR21_27880) 172865..173158 - 294 WP_004213076.1 hypothetical protein -
QJR21_RS27885 (QJR21_27885) 173174..174307 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
QJR21_RS27890 (QJR21_27890) 174915..175145 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QJR21_RS27895 (QJR21_27895) 175142..175585 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
QJR21_RS27900 (QJR21_27900) 175734..175985 + 252 WP_186987481.1 hypothetical protein -
QJR21_RS27905 (QJR21_27905) 176008..176312 - 305 Protein_181 transposase -
QJR21_RS27910 (QJR21_27910) 176729..177364 + 636 Protein_182 mucoid phenotype regulator RmpA2 -
QJR21_RS27915 (QJR21_27915) 177882..178285 - 404 Protein_183 GAF domain-containing protein -
QJR21_RS27920 (QJR21_27920) 178376..179296 - 921 WP_004213934.1 DUF1471 domain-containing protein -
QJR21_RS27925 (QJR21_27925) 179345..179836 - 492 WP_011251327.1 DM13 domain-containing protein -
QJR21_RS27930 (QJR21_27930) 179899..180174 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA2 / sul2 / tet(A) / blaLAP-2 / qnrS1 rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..302246 302246


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T282020 WP_004213072.1 NZ_CP125335:175142-175585 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT282020 WP_004213073.1 NZ_CP125335:174915-175145 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References