Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4184465..4185084 Replicon chromosome
Accession NZ_CP125334
Organism Klebsiella pneumoniae strain WYKP586

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QJR21_RS20885 Protein ID WP_002892050.1
Coordinates 4184866..4185084 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QJR21_RS20880 Protein ID WP_002892066.1
Coordinates 4184465..4184839 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR21_RS20870 (QJR21_20870) 4179617..4180810 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QJR21_RS20875 (QJR21_20875) 4180833..4183979 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
QJR21_RS20880 (QJR21_20880) 4184465..4184839 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QJR21_RS20885 (QJR21_20885) 4184866..4185084 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QJR21_RS20890 (QJR21_20890) 4185243..4185809 + 567 WP_002892030.1 maltose O-acetyltransferase -
QJR21_RS20895 (QJR21_20895) 4185781..4185921 - 141 WP_004147370.1 hypothetical protein -
QJR21_RS20900 (QJR21_20900) 4185942..4186412 + 471 WP_002892026.1 YlaC family protein -
QJR21_RS20905 (QJR21_20905) 4186387..4187838 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QJR21_RS20910 (QJR21_20910) 4187939..4188637 + 699 WP_002892021.1 GNAT family protein -
QJR21_RS20915 (QJR21_20915) 4188634..4188774 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QJR21_RS20920 (QJR21_20920) 4188774..4189037 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T282014 WP_002892050.1 NZ_CP125334:4184866-4185084 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT282014 WP_002892066.1 NZ_CP125334:4184465-4184839 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References