Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2403517..2404082 | Replicon | chromosome |
Accession | NZ_CP125315 | ||
Organism | Lacticaseibacillus rhamnosus strain k32 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QJQ50_RS11135 | Protein ID | WP_032964763.1 |
Coordinates | 2403517..2403864 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QJQ50_RS11140 | Protein ID | WP_225350938.1 |
Coordinates | 2403864..2404082 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJQ50_RS11115 (QJQ50_11115) | 2399133..2400374 | - | 1242 | WP_048482391.1 | acyltransferase | - |
QJQ50_RS11120 (QJQ50_11120) | 2400371..2401072 | - | 702 | WP_032964765.1 | ATP-binding cassette domain-containing protein | - |
QJQ50_RS11125 (QJQ50_11125) | 2401065..2401883 | - | 819 | WP_048482390.1 | ABC transporter permease subunit | - |
QJQ50_RS11130 (QJQ50_11130) | 2402124..2402792 | - | 669 | WP_005711196.1 | phenylalanine--tRNA ligase beta subunit-related protein | - |
QJQ50_RS11135 (QJQ50_11135) | 2403517..2403864 | - | 348 | WP_032964763.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QJQ50_RS11140 (QJQ50_11140) | 2403864..2404082 | - | 219 | WP_225350938.1 | transcription elongation factor GreAB | Antitoxin |
QJQ50_RS11145 (QJQ50_11145) | 2404176..2406011 | - | 1836 | WP_048482389.1 | ABC transporter ATP-binding protein | - |
QJQ50_RS11150 (QJQ50_11150) | 2405998..2407788 | - | 1791 | WP_048482388.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13148.08 Da Isoelectric Point: 9.3929
>T282003 WP_032964763.1 NZ_CP125315:c2403864-2403517 [Lacticaseibacillus rhamnosus]
MTYKAKPGDVVWLDFDPSKGHEIRKRCPAVVLSSNAYNRATGFVIVSPITSTIRTLPGYVDIVSNKIRGQIVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKPGDVVWLDFDPSKGHEIRKRCPAVVLSSNAYNRATGFVIVSPITSTIRTLPGYVDIVSNKIRGQIVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|