Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
| Location | 44860..45657 | Replicon | plasmid pCF5125-1 |
| Accession | NZ_CP125311 | ||
| Organism | Citrobacter freundii strain CF5125 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | QKW62_RS26330 | Protein ID | WP_172754447.1 |
| Coordinates | 45154..45657 (+) | Length | 168 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A5D4NAG3 |
| Locus tag | QKW62_RS26325 | Protein ID | WP_016582626.1 |
| Coordinates | 44860..45129 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW62_RS26300 (QKW62_26295) | 40483..41208 | - | 726 | WP_071684184.1 | hypothetical protein | - |
| QKW62_RS26305 (QKW62_26300) | 41490..42545 | + | 1056 | WP_001238819.1 | hypothetical protein | - |
| QKW62_RS26310 (QKW62_26305) | 42615..43370 | - | 756 | WP_071684185.1 | DUF2971 domain-containing protein | - |
| QKW62_RS26315 (QKW62_26310) | 43419..43772 | - | 354 | WP_162199642.1 | hypothetical protein | - |
| QKW62_RS26320 (QKW62_26315) | 43778..44443 | - | 666 | WP_023315962.1 | AAA family ATPase | - |
| QKW62_RS26325 (QKW62_26320) | 44860..45129 | + | 270 | WP_016582626.1 | DUF1778 domain-containing protein | Antitoxin |
| QKW62_RS26330 (QKW62_26325) | 45154..45657 | + | 504 | WP_172754447.1 | GNAT family N-acetyltransferase | Toxin |
| QKW62_RS26335 (QKW62_26330) | 45685..45849 | - | 165 | WP_230131714.1 | hypothetical protein | - |
| QKW62_RS26340 (QKW62_26335) | 45842..46093 | - | 252 | WP_004109798.1 | hypothetical protein | - |
| QKW62_RS26345 (QKW62_26340) | 46095..46787 | - | 693 | WP_071684138.1 | hypothetical protein | - |
| QKW62_RS26350 (QKW62_26345) | 46801..47124 | - | 324 | WP_000064173.1 | hypothetical protein | - |
| QKW62_RS26355 (QKW62_26350) | 47199..47987 | - | 789 | WP_071684139.1 | receptor-recognizing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..111042 | 111042 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 168 a.a. Molecular weight: 18603.30 Da Isoelectric Point: 8.8869
>T281992 WP_172754447.1 NZ_CP125311:45154-45657 [Citrobacter freundii]
MFSAQAVYDFSGFDCGEPSLNDFLQNRLVQQHNGRILRGYLLLTKDPVPKVKGFYTLSGSCFARQTLPSNTQKRKIPYAD
APSVTLGRLAIDISLQKQGYGEVLVTHALKVVYQASRAVGIYALFVDALNQSAMQFYQKFGFIPLTGANANSLFYPTKSI
EELFETE
MFSAQAVYDFSGFDCGEPSLNDFLQNRLVQQHNGRILRGYLLLTKDPVPKVKGFYTLSGSCFARQTLPSNTQKRKIPYAD
APSVTLGRLAIDISLQKQGYGEVLVTHALKVVYQASRAVGIYALFVDALNQSAMQFYQKFGFIPLTGANANSLFYPTKSI
EELFETE
Download Length: 504 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|