Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4387919..4388573 | Replicon | chromosome |
| Accession | NZ_CP125310 | ||
| Organism | Citrobacter freundii strain CF5125 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
| Locus tag | QKW62_RS21810 | Protein ID | WP_003026936.1 |
| Coordinates | 4387919..4388326 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A6H3AT26 |
| Locus tag | QKW62_RS21815 | Protein ID | WP_003026938.1 |
| Coordinates | 4388307..4388573 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW62_RS21790 (4383867) | 4383867..4385600 | - | 1734 | WP_054528765.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QKW62_RS21795 (4385606) | 4385606..4386319 | - | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QKW62_RS21800 (4386343) | 4386343..4387239 | - | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
| QKW62_RS21805 (4387353) | 4387353..4387874 | + | 522 | WP_003026933.1 | flavodoxin FldB | - |
| QKW62_RS21810 (4387919) | 4387919..4388326 | - | 408 | WP_003026936.1 | protein YgfX | Toxin |
| QKW62_RS21815 (4388307) | 4388307..4388573 | - | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
| QKW62_RS21820 (4388563) | 4388563..4388790 | - | 228 | WP_003026941.1 | hypothetical protein | - |
| QKW62_RS21825 (4388830) | 4388830..4389810 | + | 981 | WP_003026944.1 | tRNA-modifying protein YgfZ | - |
| QKW62_RS21830 (4389904) | 4389904..4390563 | - | 660 | WP_003838267.1 | hemolysin III family protein | - |
| QKW62_RS21835 (4390726) | 4390726..4391037 | - | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
| QKW62_RS21840 (4391090) | 4391090..4391818 | + | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| QKW62_RS21845 (4391939) | 4391939..4393372 | + | 1434 | WP_054528766.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T281987 WP_003026936.1 NZ_CP125310:c4388326-4387919 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NHY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H3AT26 |