Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1532482..1533102 | Replicon | chromosome |
Accession | NZ_CP125310 | ||
Organism | Citrobacter freundii strain CF5125 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QKW62_RS07435 | Protein ID | WP_002892050.1 |
Coordinates | 1532482..1532700 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | QKW62_RS07440 | Protein ID | WP_003021733.1 |
Coordinates | 1532728..1533102 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QKW62_RS07400 (1527833) | 1527833..1528462 | + | 630 | WP_054528154.1 | membrane protein | - |
QKW62_RS07405 (1528527) | 1528527..1528880 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
QKW62_RS07410 (1528932) | 1528932..1530492 | - | 1561 | Protein_1437 | EAL domain-containing protein | - |
QKW62_RS07415 (1530681) | 1530681..1530941 | + | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
QKW62_RS07420 (1530943) | 1530943..1531083 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
QKW62_RS07425 (1531162) | 1531162..1531632 | - | 471 | WP_003021724.1 | YlaC family protein | - |
QKW62_RS07430 (1531749) | 1531749..1532300 | - | 552 | WP_003021728.1 | maltose O-acetyltransferase | - |
QKW62_RS07435 (1532482) | 1532482..1532700 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QKW62_RS07440 (1532728) | 1532728..1533102 | - | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
QKW62_RS07445 (1533591) | 1533591..1536740 | - | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
QKW62_RS07450 (1536763) | 1536763..1537956 | - | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T281978 WP_002892050.1 NZ_CP125310:c1532700-1532482 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT281978 WP_003021733.1 NZ_CP125310:c1533102-1532728 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |