Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 304206..304872 | Replicon | chromosome |
Accession | NZ_CP125310 | ||
Organism | Citrobacter freundii strain CF5125 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A0J1MRN0 |
Locus tag | QKW62_RS01450 | Protein ID | WP_032938228.1 |
Coordinates | 304206..304565 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | A0A0J1QJH0 |
Locus tag | QKW62_RS01455 | Protein ID | WP_032938223.1 |
Coordinates | 304555..304872 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QKW62_RS01440 (301606) | 301606..303237 | + | 1632 | WP_003031618.1 | Na/Pi cotransporter family protein | - |
QKW62_RS01445 (303303) | 303303..303992 | - | 690 | WP_003841421.1 | dipeptidase PepE | - |
QKW62_RS01450 (304206) | 304206..304565 | + | 360 | WP_032938228.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QKW62_RS01455 (304555) | 304555..304872 | + | 318 | WP_032938223.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QKW62_RS01460 (305012) | 305012..305173 | - | 162 | WP_003841416.1 | phage protein | - |
QKW62_RS01465 (305244) | 305244..305417 | - | 174 | WP_032938222.1 | hypothetical protein | - |
QKW62_RS01470 (305549) | 305549..305914 | + | 366 | WP_054527949.1 | hypothetical protein | - |
QKW62_RS01475 (306011) | 306011..306304 | + | 294 | WP_003844689.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
QKW62_RS01480 (306304) | 306304..306621 | + | 318 | WP_054527950.1 | CcdB family protein | - |
QKW62_RS01485 (306655) | 306655..307467 | - | 813 | WP_048234164.1 | shikimate 5-dehydrogenase | - |
QKW62_RS01490 (307469) | 307469..308692 | - | 1224 | WP_003031639.1 | L-sorbose 1-phosphate reductase | - |
QKW62_RS01495 (308761) | 308761..309585 | - | 825 | WP_003031641.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13411.37 Da Isoelectric Point: 10.3350
>T281975 WP_032938228.1 NZ_CP125310:304206-304565 [Citrobacter freundii]
MTKPLYWVGHARKDLQGMPEHVRDTFGFALWLAQQGKQHSQTKSLKGFGGAGVLEVVEDHHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGHARKDLQGMPEHVRDTFGFALWLAQQGKQHSQTKSLKGFGGAGVLEVVEDHHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MRN0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1QJH0 |