Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
Location | 4121583..4122108 | Replicon | chromosome |
Accession | NZ_CP125300 | ||
Organism | Pseudomonas syringae pv. syringae strain B48 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | Q4ZPQ9 |
Locus tag | QMB36_RS17490 | Protein ID | WP_011268681.1 |
Coordinates | 4121818..4122108 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q4ZPR0 |
Locus tag | QMB36_RS17485 | Protein ID | WP_003402372.1 |
Coordinates | 4121583..4121828 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMB36_RS17480 (QMB36_17475) | 4117498..4121409 | - | 3912 | WP_054092157.1 | ATP-dependent RNA helicase HrpA | - |
QMB36_RS17485 (QMB36_17480) | 4121583..4121828 | + | 246 | WP_003402372.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QMB36_RS17490 (QMB36_17485) | 4121818..4122108 | + | 291 | WP_011268681.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMB36_RS17495 (QMB36_17490) | 4122426..4124117 | - | 1692 | WP_011268682.1 | long-chain-fatty-acid--CoA ligase FadD1 | - |
QMB36_RS17500 (QMB36_17495) | 4124472..4126160 | - | 1689 | WP_054092158.1 | long-chain-fatty-acid--CoA ligase FadD2 | - |
QMB36_RS17505 (QMB36_17500) | 4126529..4126999 | + | 471 | WP_003402365.1 | MaoC family dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11010.01 Da Isoelectric Point: 10.7294
>T281974 WP_011268681.1 NZ_CP125300:4121818-4122108 [Pseudomonas syringae pv. syringae]
MTFKLEFLPSALKEWEKLGHTIRVQLKKKLLERLGLPRIPGDALHGMPDHYKIKLRSAGYRLVYRVEEDRVVVTVVAVGK
RERGNIYDSAKGRLGP
MTFKLEFLPSALKEWEKLGHTIRVQLKKKLLERLGLPRIPGDALHGMPDHYKIKLRSAGYRLVYRVEEDRVVVTVVAVGK
RERGNIYDSAKGRLGP
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q4ZPQ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M2V2W1 |