Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
| Location | 4140417..4141056 | Replicon | chromosome |
| Accession | NZ_CP125299 | ||
| Organism | Pseudalkalibacillus hwajinpoensis strain MABIK MI00000821 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A0J6CT91 |
| Locus tag | QL286_RS20915 | Protein ID | WP_048312992.1 |
| Coordinates | 4140417..4140767 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A4U1MBT2 |
| Locus tag | QL286_RS20920 | Protein ID | WP_048312993.1 |
| Coordinates | 4140772..4141056 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QL286_RS20880 | 4135875..4136666 | - | 792 | WP_194222493.1 | RNA polymerase sigma factor SigB | - |
| QL286_RS20885 | 4136635..4137114 | - | 480 | WP_273853861.1 | anti-sigma B factor RsbW | - |
| QL286_RS20890 | 4137114..4137443 | - | 330 | WP_194222494.1 | STAS domain-containing protein | - |
| QL286_RS20895 | 4137518..4138528 | - | 1011 | WP_194222495.1 | PP2C family protein-serine/threonine phosphatase | - |
| QL286_RS20900 | 4138544..4138945 | - | 402 | WP_194222496.1 | anti-sigma regulatory factor | - |
| QL286_RS20905 | 4138949..4139305 | - | 357 | WP_194222497.1 | STAS domain-containing protein | - |
| QL286_RS20910 | 4139318..4140139 | - | 822 | WP_194222498.1 | STAS domain-containing protein | - |
| QL286_RS20915 | 4140417..4140767 | - | 351 | WP_048312992.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QL286_RS20920 | 4140772..4141056 | - | 285 | WP_048312993.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| QL286_RS20925 | 4141185..4142351 | - | 1167 | WP_283153176.1 | alanine racemase | - |
| QL286_RS20930 | 4142643..4143647 | - | 1005 | WP_242057453.1 | outer membrane lipoprotein carrier protein LolA | - |
| QL286_RS20935 | 4143708..4145240 | - | 1533 | WP_283153177.1 | NAD(P)H-hydrate dehydratase | - |
| QL286_RS20940 | 4145298..4145657 | - | 360 | WP_283153178.1 | holo-ACP synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13002.09 Da Isoelectric Point: 6.4695
>T281973 WP_048312992.1 NZ_CP125299:c4140767-4140417 [Pseudalkalibacillus hwajinpoensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDEGMMQRVQEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDEGMMQRVQEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J6CT91 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U1MBT2 |