Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 3653240..3654156 | Replicon | chromosome |
| Accession | NZ_CP125292 | ||
| Organism | Bacillus subtilis strain SRCM117797 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | QL281_RS19540 | Protein ID | WP_003244695.1 |
| Coordinates | 3653410..3654156 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | QL281_RS19535 | Protein ID | WP_003232646.1 |
| Coordinates | 3653240..3653410 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QL281_RS19500 (3650120) | 3650120..3650432 | + | 313 | Protein_3781 | XkdW family protein | - |
| QL281_RS19505 (3650429) | 3650429..3650593 | + | 165 | WP_003232658.1 | XkdX family protein | - |
| QL281_RS19510 (3650637) | 3650637..3651476 | + | 840 | WP_041351214.1 | phage-like element PBSX protein XepA | - |
| QL281_RS19515 (3651529) | 3651529..3651798 | + | 270 | WP_041351215.1 | hemolysin XhlA family protein | - |
| QL281_RS19520 (3651811) | 3651811..3652074 | + | 264 | WP_041351216.1 | phage holin | - |
| QL281_RS19525 (3652087) | 3652087..3652980 | + | 894 | WP_041351217.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QL281_RS19530 (3653017) | 3653017..3653154 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| QL281_RS19535 (3653240) | 3653240..3653410 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| QL281_RS19540 (3653410) | 3653410..3654156 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| QL281_RS19545 (3654266) | 3654266..3655267 | - | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
| QL281_RS19550 (3655280) | 3655280..3655897 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| QL281_RS19555 (3656173) | 3656173..3657489 | - | 1317 | WP_144458963.1 | serine/threonine exchanger | - |
| QL281_RS19560 (3657878) | 3657878..3658828 | + | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
| QL281_RS19565 (3658937) | 3658937..3659038 | + | 102 | Protein_3794 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T281968 WP_003244695.1 NZ_CP125292:c3654156-3653410 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|