Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2831195..2831831 | Replicon | chromosome |
| Accession | NZ_CP125292 | ||
| Organism | Bacillus subtilis strain SRCM117797 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | QL281_RS15180 | Protein ID | WP_003156187.1 |
| Coordinates | 2831481..2831831 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | QL281_RS15175 | Protein ID | WP_003225183.1 |
| Coordinates | 2831195..2831476 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QL281_RS15155 (2827555) | 2827555..2828154 | - | 600 | WP_041351790.1 | rhomboid family intramembrane serine protease | - |
| QL281_RS15160 (2828249) | 2828249..2828614 | + | 366 | WP_014475874.1 | holo-ACP synthase | - |
| QL281_RS15165 (2828780) | 2828780..2829796 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
| QL281_RS15170 (2829910) | 2829910..2831079 | + | 1170 | WP_017697002.1 | alanine racemase | - |
| QL281_RS15175 (2831195) | 2831195..2831476 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| QL281_RS15180 (2831481) | 2831481..2831831 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QL281_RS15185 (2831946) | 2831946..2832770 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| QL281_RS15190 (2832775) | 2832775..2833140 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| QL281_RS15195 (2833144) | 2833144..2833545 | + | 402 | WP_017697001.1 | serine/threonine-protein kinase RsbT | - |
| QL281_RS15200 (2833557) | 2833557..2834564 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
| QL281_RS15205 (2834626) | 2834626..2834955 | + | 330 | WP_014662855.1 | anti-sigma factor antagonist RsbV | - |
| QL281_RS15210 (2834952) | 2834952..2835434 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| QL281_RS15215 (2835400) | 2835400..2836188 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| QL281_RS15220 (2836188) | 2836188..2836787 | + | 600 | WP_017696999.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T281967 WP_003156187.1 NZ_CP125292:2831481-2831831 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|