Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 480567..481204 | Replicon | chromosome |
Accession | NZ_CP125289 | ||
Organism | Bacillus velezensis strain SF334 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QLX65_RS02495 | Protein ID | WP_003156187.1 |
Coordinates | 480854..481204 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QLX65_RS02490 | Protein ID | WP_003156188.1 |
Coordinates | 480567..480848 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLX65_RS02470 (QLX65_02470) | 476932..477531 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
QLX65_RS02475 (QLX65_02475) | 477624..477989 | + | 366 | WP_014304402.1 | holo-ACP synthase | - |
QLX65_RS02480 (QLX65_02480) | 478154..479161 | + | 1008 | WP_283002502.1 | outer membrane lipoprotein carrier protein LolA | - |
QLX65_RS02485 (QLX65_02485) | 479278..480447 | + | 1170 | WP_003156189.1 | alanine racemase | - |
QLX65_RS02490 (QLX65_02490) | 480567..480848 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QLX65_RS02495 (QLX65_02495) | 480854..481204 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QLX65_RS02500 (QLX65_02500) | 481322..482143 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
QLX65_RS02505 (QLX65_02505) | 482148..482513 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
QLX65_RS02510 (QLX65_02510) | 482516..482917 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
QLX65_RS02515 (QLX65_02515) | 482929..483936 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
QLX65_RS02520 (QLX65_02520) | 484000..484329 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
QLX65_RS02525 (QLX65_02525) | 484326..484808 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
QLX65_RS02530 (QLX65_02530) | 484774..485562 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
QLX65_RS02535 (QLX65_02535) | 485562..486164 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T281961 WP_003156187.1 NZ_CP125289:480854-481204 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|