Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4848964..4849572 | Replicon | chromosome |
Accession | NZ_CP125288 | ||
Organism | Pseudomonas aeruginosa strain SF416 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | QLX61_RS22360 | Protein ID | WP_023090047.1 |
Coordinates | 4848964..4849311 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | QLX61_RS22365 | Protein ID | WP_003114155.1 |
Coordinates | 4849321..4849572 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLX61_RS22330 (QLX61_22325) | 4844383..4844595 | + | 213 | WP_003098360.1 | cysteine-rich CWC family protein | - |
QLX61_RS22335 (QLX61_22330) | 4844595..4845287 | + | 693 | WP_023084583.1 | 16S rRNA pseudouridine(516) synthase | - |
QLX61_RS22340 (QLX61_22335) | 4845423..4846466 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
QLX61_RS22345 (QLX61_22340) | 4846546..4847283 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
QLX61_RS22350 (QLX61_22345) | 4847735..4848637 | + | 903 | WP_023084584.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
QLX61_RS22360 (QLX61_22355) | 4848964..4849311 | - | 348 | WP_023090047.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QLX61_RS22365 (QLX61_22360) | 4849321..4849572 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QLX61_RS22370 (QLX61_22365) | 4849785..4850767 | - | 983 | Protein_4425 | tyrosine-type recombinase/integrase | - |
QLX61_RS22375 (QLX61_22370) | 4850767..4852059 | - | 1293 | WP_023090049.1 | hypothetical protein | - |
QLX61_RS22380 (QLX61_22375) | 4852697..4853086 | - | 390 | WP_034053350.1 | hypothetical protein | - |
QLX61_RS22385 (QLX61_22380) | 4853079..4853294 | - | 216 | WP_023090052.1 | hypothetical protein | - |
QLX61_RS22390 (QLX61_22385) | 4853317..4853532 | - | 216 | WP_023090053.1 | hypothetical protein | - |
QLX61_RS22395 (QLX61_22390) | 4853684..4853929 | + | 246 | WP_228380994.1 | DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4848814..4858792 | 9978 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12923.74 Da Isoelectric Point: 4.5143
>T281959 WP_023090047.1 NZ_CP125288:c4849311-4848964 [Pseudomonas aeruginosa]
MTQVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPISQQASLLGVLSYRELNTGPYRIFY
ELHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIG
MTQVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPISQQASLLGVLSYRELNTGPYRIFY
ELHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIG
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|