Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 164077..164582 | Replicon | chromosome |
Accession | NZ_CP125288 | ||
Organism | Pseudomonas aeruginosa strain SF416 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QLX61_RS00740 | Protein ID | WP_023090221.1 |
Coordinates | 164077..164358 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | QLX61_RS00745 | Protein ID | WP_003083775.1 |
Coordinates | 164355..164582 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLX61_RS00715 (QLX61_00715) | 159328..160677 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
QLX61_RS00720 (QLX61_00720) | 160726..161412 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
QLX61_RS00725 (QLX61_00725) | 161513..162247 | + | 735 | WP_023090219.1 | GntR family transcriptional regulator | - |
QLX61_RS00730 (QLX61_00730) | 162427..162837 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
QLX61_RS00735 (QLX61_00735) | 162869..163777 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
QLX61_RS00740 (QLX61_00740) | 164077..164358 | - | 282 | WP_023090221.1 | type II toxin-antitoxin system toxin ParE | Toxin |
QLX61_RS00745 (QLX61_00745) | 164355..164582 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QLX61_RS00750 (QLX61_00750) | 164757..165377 | - | 621 | WP_003101226.1 | hypothetical protein | - |
QLX61_RS00755 (QLX61_00755) | 165478..165978 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
QLX61_RS00760 (QLX61_00760) | 166051..166392 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
QLX61_RS00765 (QLX61_00765) | 166474..167901 | - | 1428 | WP_003083784.1 | GABA permease | - |
QLX61_RS00770 (QLX61_00770) | 168070..169563 | - | 1494 | WP_126584470.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10463.18 Da Isoelectric Point: 9.6558
>T281955 WP_023090221.1 NZ_CP125288:c164358-164077 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVADQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVADQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|