Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1236292..1237209 | Replicon | chromosome |
Accession | NZ_CP125283 | ||
Organism | Bacillus velezensis strain IFST-221 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | QLX50_RS06470 | Protein ID | WP_007407256.1 |
Coordinates | 1236463..1237209 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | QLX50_RS06465 | Protein ID | WP_003154807.1 |
Coordinates | 1236292..1236462 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLX50_RS06425 (QLX50_06425) | 1231504..1233093 | + | 1590 | WP_044802869.1 | hypothetical protein | - |
QLX50_RS06430 (QLX50_06430) | 1233106..1233531 | + | 426 | WP_083061813.1 | hypothetical protein | - |
QLX50_RS06435 (QLX50_06435) | 1233536..1233733 | + | 198 | WP_007610833.1 | XkdX family protein | - |
QLX50_RS06440 (QLX50_06440) | 1233790..1234551 | + | 762 | WP_044802871.1 | hypothetical protein | - |
QLX50_RS06445 (QLX50_06445) | 1234603..1234866 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
QLX50_RS06450 (QLX50_06450) | 1234880..1235143 | + | 264 | WP_003154813.1 | phage holin | - |
QLX50_RS06455 (QLX50_06455) | 1235157..1236035 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
QLX50_RS06460 (QLX50_06460) | 1236070..1236195 | - | 126 | WP_003154809.1 | hypothetical protein | - |
QLX50_RS06465 (QLX50_06465) | 1236292..1236462 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QLX50_RS06470 (QLX50_06470) | 1236463..1237209 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QLX50_RS06475 (QLX50_06475) | 1237316..1238314 | - | 999 | WP_044802872.1 | inorganic phosphate transporter | - |
QLX50_RS06480 (QLX50_06480) | 1238327..1238944 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
QLX50_RS06485 (QLX50_06485) | 1239231..1240547 | - | 1317 | WP_044802873.1 | amino acid permease | - |
QLX50_RS06490 (QLX50_06490) | 1240870..1241820 | + | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1202675..1245437 | 42762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T281954 WP_007407256.1 NZ_CP125283:c1237209-1236463 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|