Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 477058..477695 | Replicon | chromosome |
Accession | NZ_CP125283 | ||
Organism | Bacillus velezensis strain IFST-221 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QLX50_RS02430 | Protein ID | WP_003156187.1 |
Coordinates | 477345..477695 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QLX50_RS02425 | Protein ID | WP_003156188.1 |
Coordinates | 477058..477339 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLX50_RS02405 (QLX50_02405) | 473423..474022 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
QLX50_RS02410 (QLX50_02410) | 474115..474480 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
QLX50_RS02415 (QLX50_02415) | 474645..475652 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
QLX50_RS02420 (QLX50_02420) | 475769..476938 | + | 1170 | WP_044802654.1 | alanine racemase | - |
QLX50_RS02425 (QLX50_02425) | 477058..477339 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QLX50_RS02430 (QLX50_02430) | 477345..477695 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QLX50_RS02435 (QLX50_02435) | 477813..478634 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
QLX50_RS02440 (QLX50_02440) | 478639..479004 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
QLX50_RS02445 (QLX50_02445) | 479007..479408 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
QLX50_RS02450 (QLX50_02450) | 479420..480427 | + | 1008 | WP_044802655.1 | PP2C family protein-serine/threonine phosphatase | - |
QLX50_RS02455 (QLX50_02455) | 480491..480820 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
QLX50_RS02460 (QLX50_02460) | 480817..481299 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
QLX50_RS02465 (QLX50_02465) | 481265..482053 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
QLX50_RS02470 (QLX50_02470) | 482053..482655 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T281953 WP_003156187.1 NZ_CP125283:477345-477695 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|