Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1296272..1297189 | Replicon | chromosome |
| Accession | NZ_CP125279 | ||
| Organism | Bacillus velezensis strain FLU-1 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | - |
| Locus tag | QLH34_RS06930 | Protein ID | WP_032866111.1 |
| Coordinates | 1296443..1297189 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | QLH34_RS06925 | Protein ID | WP_003154807.1 |
| Coordinates | 1296272..1296442 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLH34_RS06890 (1291484) | 1291484..1293073 | + | 1590 | WP_205164551.1 | hypothetical protein | - |
| QLH34_RS06895 (1293086) | 1293086..1293511 | + | 426 | WP_050498185.1 | hypothetical protein | - |
| QLH34_RS06900 (1293516) | 1293516..1293713 | + | 198 | WP_007610833.1 | XkdX family protein | - |
| QLH34_RS06905 (1293770) | 1293770..1294531 | + | 762 | WP_020955694.1 | hypothetical protein | - |
| QLH34_RS06910 (1294583) | 1294583..1294846 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| QLH34_RS06915 (1294860) | 1294860..1295123 | + | 264 | WP_003154813.1 | phage holin | - |
| QLH34_RS06920 (1295137) | 1295137..1296015 | + | 879 | WP_020955695.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QLH34_RS06925 (1296272) | 1296272..1296442 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| QLH34_RS06930 (1296443) | 1296443..1297189 | - | 747 | WP_032866111.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QLH34_RS06935 (1297293) | 1297293..1298291 | - | 999 | WP_020955696.1 | inorganic phosphate transporter | - |
| QLH34_RS06940 (1298304) | 1298304..1298921 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
| QLH34_RS06945 (1299207) | 1299207..1300523 | - | 1317 | WP_007407254.1 | amino acid permease | - |
| QLH34_RS06950 (1300846) | 1300846..1301796 | + | 951 | WP_218791607.1 | ring-cleaving dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1261268..1305446 | 44178 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29095.60 Da Isoelectric Point: 4.7755
>T281952 WP_032866111.1 NZ_CP125279:c1297189-1296443 [Bacillus velezensis]
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|