Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 75233..75886 | Replicon | chromosome |
Accession | NZ_CP125227 | ||
Organism | Acinetobacter pittii strain SO1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OH685_RS00390 | Protein ID | WP_086399324.1 |
Coordinates | 75233..75622 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A009HHW9 |
Locus tag | OH685_RS00395 | Protein ID | WP_002117064.1 |
Coordinates | 75629..75886 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH685_RS00375 (OH685_00370) | 70339..72534 | - | 2196 | WP_005067292.1 | TRAP transporter large permease subunit | - |
OH685_RS00380 (OH685_00375) | 72714..73289 | - | 576 | WP_005067290.1 | rhombosortase | - |
OH685_RS00385 (OH685_00380) | 73374..74462 | - | 1089 | WP_202744799.1 | hypothetical protein | - |
OH685_RS00390 (OH685_00390) | 75233..75622 | - | 390 | WP_086399324.1 | hypothetical protein | Toxin |
OH685_RS00395 (OH685_00395) | 75629..75886 | - | 258 | WP_002117064.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OH685_RS00400 (OH685_00400) | 76075..77247 | + | 1173 | WP_282463629.1 | acyl-CoA dehydrogenase family protein | - |
OH685_RS00405 (OH685_00405) | 77298..78788 | - | 1491 | WP_002116796.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OH685_RS00410 (OH685_00410) | 78970..79347 | - | 378 | WP_002049717.1 | 50S ribosomal protein L17 | - |
OH685_RS00415 (OH685_00415) | 79366..80373 | - | 1008 | WP_002116730.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15586.65 Da Isoelectric Point: 6.3102
>T281950 WP_086399324.1 NZ_CP125227:c75622-75233 [Acinetobacter pittii]
MIKELNFELKYSRVSVVFQLFVGLGLAILLYQLLTPMWWLCAVILLFIGFIFFLKQVQISQIEYLDQKLWSVAYFSEKEI
YRAEITKIIDYQLFVVIYFEETPTNIAIVWFDQLPIQQWKRLKVLEKLY
MIKELNFELKYSRVSVVFQLFVGLGLAILLYQLLTPMWWLCAVILLFIGFIFFLKQVQISQIEYLDQKLWSVAYFSEKEI
YRAEITKIIDYQLFVVIYFEETPTNIAIVWFDQLPIQQWKRLKVLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|