Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2375263..2375942 | Replicon | chromosome |
Accession | NZ_CP125225 | ||
Organism | Acinetobacter baumannii strain EGA10 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7Z1VKH9 |
Locus tag | QMA75_RS11390 | Protein ID | WP_000838148.1 |
Coordinates | 2375760..2375942 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | N9L2H6 |
Locus tag | QMA75_RS11385 | Protein ID | WP_000966688.1 |
Coordinates | 2375263..2375667 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMA75_RS11370 (QMA75_11370) | 2371570..2373216 | - | 1647 | WP_003383679.1 | phosphoethanolamine--lipid A transferase | - |
QMA75_RS11375 (QMA75_11375) | 2373521..2374453 | + | 933 | WP_001043692.1 | IS5-like element ISAba13 family transposase | - |
QMA75_RS11380 (QMA75_11380) | 2374654..2375163 | - | 510 | WP_000734512.1 | hypothetical protein | - |
QMA75_RS11385 (QMA75_11385) | 2375263..2375667 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QMA75_RS11390 (QMA75_11390) | 2375760..2375942 | - | 183 | WP_000838148.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QMA75_RS11395 (QMA75_11395) | 2376268..2376783 | - | 516 | WP_001185594.1 | hypothetical protein | - |
QMA75_RS11400 (QMA75_11400) | 2376853..2377770 | - | 918 | WP_000094259.1 | phage tail tube protein | - |
QMA75_RS11405 (QMA75_11405) | 2377823..2378788 | - | 966 | WP_000002429.1 | hypothetical protein | - |
QMA75_RS11410 (QMA75_11410) | 2378788..2379138 | - | 351 | WP_000065011.1 | hypothetical protein | - |
QMA75_RS11415 (QMA75_11415) | 2379207..2379605 | - | 399 | WP_001251875.1 | phage tail terminator-like protein | - |
QMA75_RS11420 (QMA75_11420) | 2379607..2379975 | - | 369 | WP_000539750.1 | hypothetical protein | - |
QMA75_RS11425 (QMA75_11425) | 2379947..2380354 | - | 408 | WP_000247950.1 | hypothetical protein | - |
QMA75_RS11430 (QMA75_11430) | 2380363..2380731 | - | 369 | WP_002019566.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2373521..2407816 | 34295 | |
- | flank | IS/Tn | - | - | 2373521..2374453 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6677.82 Da Isoelectric Point: 10.5523
>T281948 WP_000838148.1 NZ_CP125225:c2375942-2375760 [Acinetobacter baumannii]
VKSLDLIKMIEADSWYEVRVSGSHHHVKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADSWYEVRVSGSHHHVKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT281948 WP_000966688.1 NZ_CP125225:c2375667-2375263 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z1VKH9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9L2H6 |