Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 455814..456467 | Replicon | chromosome |
Accession | NZ_CP125225 | ||
Organism | Acinetobacter baumannii strain EGA10 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | QMA75_RS02235 | Protein ID | WP_000607077.1 |
Coordinates | 456078..456467 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | QMA75_RS02230 | Protein ID | WP_001288210.1 |
Coordinates | 455814..456071 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMA75_RS02210 (QMA75_02210) | 451330..452337 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
QMA75_RS02215 (QMA75_02215) | 452356..452733 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
QMA75_RS02220 (QMA75_02220) | 452915..454405 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
QMA75_RS02225 (QMA75_02225) | 454454..455626 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
QMA75_RS02230 (QMA75_02230) | 455814..456071 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
QMA75_RS02235 (QMA75_02235) | 456078..456467 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
QMA75_RS02240 (QMA75_02240) | 457237..458322 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
QMA75_RS02245 (QMA75_02245) | 458400..458966 | + | 567 | WP_000651538.1 | rhombosortase | - |
QMA75_RS02250 (QMA75_02250) | 459154..461349 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T281947 WP_000607077.1 NZ_CP125225:456078-456467 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|