Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2388340..2389019 | Replicon | chromosome |
Accession | NZ_CP125223 | ||
Organism | Acinetobacter baumannii strain EGA65 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7Z1VKH9 |
Locus tag | QMA76_RS11445 | Protein ID | WP_000838148.1 |
Coordinates | 2388837..2389019 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | N9L2H6 |
Locus tag | QMA76_RS11440 | Protein ID | WP_000966688.1 |
Coordinates | 2388340..2388744 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMA76_RS11425 (QMA76_11425) | 2384647..2386293 | - | 1647 | WP_031955564.1 | phosphoethanolamine--lipid A transferase | - |
QMA76_RS11430 (QMA76_11430) | 2386598..2387530 | + | 933 | WP_001043692.1 | IS5-like element ISAba13 family transposase | - |
QMA76_RS11435 (QMA76_11435) | 2387731..2388240 | - | 510 | WP_000734512.1 | hypothetical protein | - |
QMA76_RS11440 (QMA76_11440) | 2388340..2388744 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QMA76_RS11445 (QMA76_11445) | 2388837..2389019 | - | 183 | WP_000838148.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QMA76_RS11450 (QMA76_11450) | 2389345..2389860 | - | 516 | WP_001185594.1 | hypothetical protein | - |
QMA76_RS11455 (QMA76_11455) | 2389930..2390847 | - | 918 | WP_000094259.1 | phage tail tube protein | - |
QMA76_RS11460 (QMA76_11460) | 2390900..2391865 | - | 966 | WP_000002429.1 | hypothetical protein | - |
QMA76_RS11465 (QMA76_11465) | 2391865..2392215 | - | 351 | WP_000065011.1 | hypothetical protein | - |
QMA76_RS11470 (QMA76_11470) | 2392284..2392682 | - | 399 | WP_001251875.1 | phage tail terminator-like protein | - |
QMA76_RS11475 (QMA76_11475) | 2392684..2393052 | - | 369 | WP_000539750.1 | hypothetical protein | - |
QMA76_RS11480 (QMA76_11480) | 2393024..2393431 | - | 408 | WP_000247950.1 | hypothetical protein | - |
QMA76_RS11485 (QMA76_11485) | 2393440..2393808 | - | 369 | WP_002019566.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2386598..2427987 | 41389 | |
- | flank | IS/Tn | - | - | 2386598..2387530 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6677.82 Da Isoelectric Point: 10.5523
>T281945 WP_000838148.1 NZ_CP125223:c2389019-2388837 [Acinetobacter baumannii]
VKSLDLIKMIEADSWYEVRVSGSHHHVKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADSWYEVRVSGSHHHVKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT281945 WP_000966688.1 NZ_CP125223:c2388744-2388340 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z1VKH9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9L2H6 |